Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9R584

Protein Details
Accession A0A1L9R584    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
86-112EKMAEKMHRKRVERLKRREKRNKLLNSBasic
NLS Segment(s)
PositionSequence
61-108KEAEKQAQIQKMKERRAAKEEKERYEKMAEKMHRKRVERLKRREKRNK
Subcellular Location(s) nucl 16.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSTTTPVVPAVKGMRKNGKNWHDSKKPFRPTSGMTSYAKRLETRKHQDAVKEHEKELKEEKEAEKQAQIQKMKERRAAKEEKERYEKMAEKMHRKRVERLKRREKRNKLLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.55
4 0.61
5 0.63
6 0.65
7 0.67
8 0.69
9 0.68
10 0.73
11 0.77
12 0.77
13 0.78
14 0.72
15 0.69
16 0.64
17 0.58
18 0.59
19 0.54
20 0.48
21 0.4
22 0.4
23 0.4
24 0.38
25 0.35
26 0.29
27 0.28
28 0.31
29 0.39
30 0.45
31 0.48
32 0.49
33 0.49
34 0.52
35 0.53
36 0.55
37 0.53
38 0.46
39 0.41
40 0.42
41 0.4
42 0.38
43 0.38
44 0.31
45 0.24
46 0.25
47 0.26
48 0.29
49 0.3
50 0.29
51 0.26
52 0.29
53 0.32
54 0.35
55 0.36
56 0.32
57 0.39
58 0.45
59 0.48
60 0.5
61 0.51
62 0.5
63 0.55
64 0.61
65 0.59
66 0.63
67 0.65
68 0.66
69 0.68
70 0.64
71 0.6
72 0.59
73 0.57
74 0.51
75 0.52
76 0.51
77 0.55
78 0.62
79 0.69
80 0.7
81 0.68
82 0.74
83 0.76
84 0.8
85 0.8
86 0.82
87 0.83
88 0.85
89 0.92
90 0.93
91 0.93
92 0.93