Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9RA46

Protein Details
Accession A0A1L9RA46   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
144-170MLDLTDPSKRRRRRRSRSRRFAVDILAHydrophilic
NLS Segment(s)
PositionSequence
151-163SKRRRRRRSRSRR
Subcellular Location(s) plas 12, E.R. 4, nucl 3, golg 3, mito 2, cyto_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MCLMHDACVVLFYYYYYFFFTFIIMGGRLLGMTWCCFGYTRIFLVTSWELIDISFLSSPLLLLSFPTITSYYHYDCRYCEALFFIFIIFIILLFLQWSDPAKRRSEPEVDRGRMSATSGVGRIMHDNSKKEKEQKKTKASDGMMLDLTDPSKRRRRRRSRSRRFAVDILAGISI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.14
4 0.13
5 0.14
6 0.14
7 0.13
8 0.12
9 0.11
10 0.12
11 0.09
12 0.09
13 0.08
14 0.08
15 0.07
16 0.07
17 0.07
18 0.06
19 0.07
20 0.08
21 0.08
22 0.09
23 0.1
24 0.11
25 0.15
26 0.16
27 0.17
28 0.17
29 0.17
30 0.17
31 0.22
32 0.21
33 0.17
34 0.15
35 0.14
36 0.12
37 0.11
38 0.12
39 0.07
40 0.07
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.05
47 0.05
48 0.04
49 0.04
50 0.05
51 0.05
52 0.05
53 0.07
54 0.07
55 0.07
56 0.1
57 0.13
58 0.14
59 0.19
60 0.2
61 0.19
62 0.19
63 0.23
64 0.23
65 0.19
66 0.17
67 0.14
68 0.13
69 0.13
70 0.13
71 0.08
72 0.06
73 0.06
74 0.06
75 0.04
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.05
85 0.08
86 0.13
87 0.16
88 0.19
89 0.21
90 0.24
91 0.29
92 0.36
93 0.36
94 0.41
95 0.47
96 0.46
97 0.45
98 0.42
99 0.39
100 0.3
101 0.28
102 0.21
103 0.13
104 0.12
105 0.11
106 0.12
107 0.11
108 0.12
109 0.13
110 0.13
111 0.18
112 0.21
113 0.25
114 0.31
115 0.36
116 0.41
117 0.49
118 0.54
119 0.59
120 0.66
121 0.72
122 0.76
123 0.76
124 0.77
125 0.76
126 0.69
127 0.65
128 0.56
129 0.49
130 0.4
131 0.33
132 0.28
133 0.2
134 0.19
135 0.16
136 0.17
137 0.22
138 0.31
139 0.4
140 0.51
141 0.61
142 0.72
143 0.8
144 0.89
145 0.93
146 0.95
147 0.97
148 0.96
149 0.94
150 0.9
151 0.82
152 0.76
153 0.69
154 0.58