Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VBY9

Protein Details
Accession G0VBY9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
91-115AKARDSQKCKILKRRRLKGRWYLTHHydrophilic
NLS Segment(s)
PositionSequence
82-110KRKRKFGFLAKARDSQKCKILKRRRLKGR
Subcellular Location(s) mito 21.5, mito_nucl 13.333, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncs:NCAS_0B03820  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MSLFNRISSHLRPVTLGAGTRWFSMGTSSSLGLIRQGITGLGSPMGSNVLSQSPMMGSLLPFGILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.25
4 0.18
5 0.2
6 0.21
7 0.2
8 0.19
9 0.16
10 0.14
11 0.15
12 0.15
13 0.12
14 0.13
15 0.12
16 0.13
17 0.13
18 0.13
19 0.12
20 0.11
21 0.09
22 0.08
23 0.08
24 0.06
25 0.06
26 0.07
27 0.06
28 0.06
29 0.05
30 0.05
31 0.05
32 0.06
33 0.05
34 0.05
35 0.05
36 0.05
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.06
43 0.05
44 0.04
45 0.04
46 0.04
47 0.05
48 0.05
49 0.05
50 0.08
51 0.1
52 0.16
53 0.21
54 0.25
55 0.29
56 0.35
57 0.4
58 0.47
59 0.55
60 0.59
61 0.61
62 0.61
63 0.66
64 0.63
65 0.64
66 0.64
67 0.62
68 0.64
69 0.62
70 0.69
71 0.63
72 0.68
73 0.71
74 0.72
75 0.74
76 0.72
77 0.75
78 0.69
79 0.74
80 0.69
81 0.69
82 0.64
83 0.58
84 0.58
85 0.57
86 0.61
87 0.65
88 0.71
89 0.74
90 0.79
91 0.85
92 0.88
93 0.89
94 0.9
95 0.9