Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9RJ64

Protein Details
Accession A0A1L9RJ64    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
32-63SIRQSNTKKKKKEEAEKKKKKKKESANELLEGBasic
NLS Segment(s)
PositionSequence
38-54TKKKKKEEAEKKKKKKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.833, mito_nucl 11.166, cyto 5
Family & Domain DBs
Amino Acid Sequences MPPCLFGFHIILYNTSLDKGKGENVQGDGGSSIRQSNTKKKKKEEAEKKKKKKKESANELLEGQYSNYANATHIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.11
5 0.12
6 0.12
7 0.14
8 0.16
9 0.18
10 0.19
11 0.19
12 0.2
13 0.18
14 0.17
15 0.14
16 0.11
17 0.1
18 0.08
19 0.07
20 0.07
21 0.11
22 0.14
23 0.24
24 0.35
25 0.44
26 0.5
27 0.56
28 0.65
29 0.71
30 0.79
31 0.8
32 0.81
33 0.83
34 0.88
35 0.93
36 0.93
37 0.91
38 0.9
39 0.89
40 0.88
41 0.88
42 0.87
43 0.87
44 0.83
45 0.78
46 0.69
47 0.6
48 0.49
49 0.38
50 0.28
51 0.22
52 0.16
53 0.13
54 0.13
55 0.12