Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9RLY9

Protein Details
Accession A0A1L9RLY9   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-21WSVRSHPQTKREQLRLQLSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 4, cyto 4, cyto_nucl 4, pero 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR022751  Alpha_mannosyltransferase  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016757  F:glycosyltransferase activity  
GO:0048856  P:anatomical structure development  
GO:0006486  P:protein glycosylation  
GO:0043934  P:sporulation  
Pfam View protein in Pfam  
PF11051  Mannosyl_trans3  
Amino Acid Sequences MWSVRSHPQTKREQLRLQLSSLLHDHKPNCAAIQLDGDAGGAYYNASDEGERLNCVKNVDEIFPPMQAAHDGFLRAIQDQKVQLPYLPQTAGIVSSAGGTYLPNFIVTLRLIRRRGSNLPVEVFMKDWEEYEAYICEVVLPPMNAKCLILSEMLSGLNKMEHYQIKSFAILFSSFESVIWLDSDNIPLHDPGILLNSEPFTSTGLVTWPDFWASTTAPIYYNISRQPEPSLSARACSEAGVILVSKQSHASMLLLSAYYNYYGPDYYYPLLSQGGYGQGDKDTFIPAAAAMNKTFYTVSEPVVFLGHTLPHSEDVHPAAMLQSDPIEDFQLTSEGKWRVKDPSVAKPVRAFFIHTMAMKFNPADGLMGEKSHDWHGNPSRAYTASAEALQRFGYDAERDIWEETLAMTCDLEHVFYTWRSKSGVCAEVRAYWNAVYENPSKEETYKFTQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.75
4 0.67
5 0.63
6 0.53
7 0.47
8 0.45
9 0.41
10 0.33
11 0.37
12 0.36
13 0.35
14 0.38
15 0.35
16 0.32
17 0.29
18 0.28
19 0.23
20 0.26
21 0.21
22 0.17
23 0.16
24 0.15
25 0.12
26 0.11
27 0.09
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.05
35 0.06
36 0.11
37 0.12
38 0.13
39 0.15
40 0.19
41 0.2
42 0.21
43 0.22
44 0.23
45 0.25
46 0.26
47 0.25
48 0.26
49 0.25
50 0.24
51 0.23
52 0.18
53 0.16
54 0.15
55 0.14
56 0.11
57 0.12
58 0.12
59 0.11
60 0.13
61 0.13
62 0.12
63 0.15
64 0.15
65 0.18
66 0.19
67 0.24
68 0.25
69 0.25
70 0.25
71 0.25
72 0.26
73 0.26
74 0.24
75 0.2
76 0.18
77 0.17
78 0.17
79 0.13
80 0.1
81 0.07
82 0.07
83 0.07
84 0.06
85 0.06
86 0.05
87 0.06
88 0.07
89 0.07
90 0.07
91 0.07
92 0.07
93 0.09
94 0.1
95 0.15
96 0.19
97 0.26
98 0.28
99 0.31
100 0.35
101 0.39
102 0.44
103 0.43
104 0.45
105 0.41
106 0.41
107 0.41
108 0.38
109 0.32
110 0.28
111 0.22
112 0.18
113 0.14
114 0.12
115 0.12
116 0.11
117 0.11
118 0.11
119 0.11
120 0.09
121 0.09
122 0.08
123 0.07
124 0.07
125 0.07
126 0.08
127 0.08
128 0.09
129 0.1
130 0.12
131 0.11
132 0.11
133 0.1
134 0.1
135 0.11
136 0.1
137 0.09
138 0.08
139 0.09
140 0.1
141 0.09
142 0.08
143 0.07
144 0.07
145 0.07
146 0.07
147 0.11
148 0.14
149 0.17
150 0.19
151 0.21
152 0.21
153 0.22
154 0.21
155 0.17
156 0.15
157 0.12
158 0.11
159 0.1
160 0.11
161 0.1
162 0.09
163 0.1
164 0.08
165 0.08
166 0.08
167 0.07
168 0.06
169 0.07
170 0.09
171 0.09
172 0.09
173 0.1
174 0.09
175 0.09
176 0.08
177 0.08
178 0.06
179 0.08
180 0.07
181 0.06
182 0.07
183 0.07
184 0.07
185 0.07
186 0.07
187 0.06
188 0.07
189 0.07
190 0.07
191 0.07
192 0.08
193 0.08
194 0.08
195 0.08
196 0.07
197 0.07
198 0.07
199 0.08
200 0.07
201 0.09
202 0.09
203 0.09
204 0.1
205 0.1
206 0.13
207 0.12
208 0.14
209 0.15
210 0.19
211 0.18
212 0.19
213 0.2
214 0.19
215 0.2
216 0.2
217 0.22
218 0.18
219 0.19
220 0.18
221 0.17
222 0.16
223 0.14
224 0.12
225 0.07
226 0.07
227 0.06
228 0.05
229 0.04
230 0.06
231 0.06
232 0.06
233 0.06
234 0.06
235 0.06
236 0.07
237 0.07
238 0.05
239 0.06
240 0.06
241 0.05
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05
247 0.05
248 0.06
249 0.06
250 0.07
251 0.07
252 0.1
253 0.1
254 0.1
255 0.1
256 0.1
257 0.11
258 0.1
259 0.09
260 0.07
261 0.09
262 0.09
263 0.1
264 0.09
265 0.09
266 0.09
267 0.1
268 0.1
269 0.08
270 0.08
271 0.07
272 0.07
273 0.06
274 0.08
275 0.1
276 0.1
277 0.09
278 0.11
279 0.11
280 0.11
281 0.11
282 0.09
283 0.14
284 0.14
285 0.16
286 0.16
287 0.16
288 0.16
289 0.16
290 0.16
291 0.1
292 0.1
293 0.09
294 0.08
295 0.09
296 0.09
297 0.12
298 0.14
299 0.14
300 0.15
301 0.16
302 0.16
303 0.15
304 0.14
305 0.11
306 0.1
307 0.09
308 0.07
309 0.06
310 0.06
311 0.06
312 0.07
313 0.08
314 0.07
315 0.07
316 0.08
317 0.11
318 0.11
319 0.1
320 0.17
321 0.2
322 0.22
323 0.24
324 0.26
325 0.28
326 0.31
327 0.39
328 0.37
329 0.43
330 0.51
331 0.51
332 0.51
333 0.51
334 0.49
335 0.45
336 0.4
337 0.34
338 0.26
339 0.28
340 0.29
341 0.25
342 0.25
343 0.24
344 0.23
345 0.21
346 0.19
347 0.15
348 0.13
349 0.12
350 0.11
351 0.09
352 0.13
353 0.12
354 0.12
355 0.13
356 0.12
357 0.14
358 0.17
359 0.2
360 0.17
361 0.25
362 0.33
363 0.4
364 0.4
365 0.4
366 0.39
367 0.37
368 0.38
369 0.31
370 0.26
371 0.21
372 0.23
373 0.24
374 0.21
375 0.21
376 0.19
377 0.17
378 0.15
379 0.13
380 0.14
381 0.12
382 0.14
383 0.16
384 0.17
385 0.19
386 0.19
387 0.19
388 0.16
389 0.14
390 0.13
391 0.13
392 0.12
393 0.11
394 0.1
395 0.09
396 0.11
397 0.11
398 0.11
399 0.09
400 0.09
401 0.12
402 0.16
403 0.22
404 0.21
405 0.23
406 0.25
407 0.25
408 0.3
409 0.34
410 0.38
411 0.34
412 0.36
413 0.36
414 0.41
415 0.44
416 0.4
417 0.34
418 0.27
419 0.28
420 0.25
421 0.25
422 0.23
423 0.25
424 0.28
425 0.29
426 0.31
427 0.31
428 0.32
429 0.35
430 0.36