Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9RVT8

Protein Details
Accession A0A1L9RVT8    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-29FSNRIRRSEMIKREKKNKKNMSLKGMSYHydrophilic
NLS Segment(s)
PositionSequence
11-20MIKREKKNKK
84-103RARSRGHSRGRNGAGGKRSG
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MFSNRIRRSEMIKREKKNKKNMSLKGMSYADWGRIARLQGRAQDEGKRSREESRHAAVSKANRAASLSGSCGLGRAGHLVRDERARSRGHSRGRNGAGGKRSGRSVDGSDGLDPDKGLGDGRRAGGSGGVCSDKRGGCEAEDRSNRGDLHFGLVSLPDWRRGNMDRIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.86
3 0.87
4 0.88
5 0.88
6 0.87
7 0.89
8 0.88
9 0.87
10 0.83
11 0.74
12 0.71
13 0.61
14 0.51
15 0.44
16 0.37
17 0.29
18 0.25
19 0.24
20 0.18
21 0.19
22 0.21
23 0.21
24 0.25
25 0.26
26 0.28
27 0.32
28 0.35
29 0.34
30 0.39
31 0.4
32 0.42
33 0.43
34 0.41
35 0.38
36 0.42
37 0.44
38 0.44
39 0.45
40 0.41
41 0.44
42 0.42
43 0.41
44 0.37
45 0.38
46 0.38
47 0.35
48 0.31
49 0.24
50 0.25
51 0.24
52 0.22
53 0.18
54 0.14
55 0.1
56 0.11
57 0.1
58 0.1
59 0.09
60 0.07
61 0.06
62 0.08
63 0.08
64 0.09
65 0.1
66 0.11
67 0.12
68 0.16
69 0.17
70 0.16
71 0.19
72 0.19
73 0.21
74 0.26
75 0.32
76 0.37
77 0.43
78 0.44
79 0.48
80 0.49
81 0.51
82 0.46
83 0.44
84 0.39
85 0.36
86 0.35
87 0.28
88 0.27
89 0.23
90 0.22
91 0.2
92 0.19
93 0.17
94 0.17
95 0.17
96 0.16
97 0.16
98 0.15
99 0.13
100 0.11
101 0.09
102 0.07
103 0.06
104 0.07
105 0.07
106 0.09
107 0.11
108 0.13
109 0.13
110 0.13
111 0.13
112 0.14
113 0.13
114 0.11
115 0.11
116 0.13
117 0.13
118 0.14
119 0.18
120 0.16
121 0.17
122 0.2
123 0.19
124 0.18
125 0.25
126 0.28
127 0.34
128 0.37
129 0.38
130 0.37
131 0.41
132 0.39
133 0.34
134 0.33
135 0.23
136 0.25
137 0.22
138 0.2
139 0.16
140 0.17
141 0.16
142 0.18
143 0.19
144 0.21
145 0.22
146 0.23
147 0.28
148 0.31