Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9R7A9

Protein Details
Accession A0A1L9R7A9    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-30VNVPKTRRTYCKSKECHKHTQHKVTQYKAHydrophilic
73-92ECTACKTKKQLALKRCKHFEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 7, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences QVNVPKTRRTYCKSKECHKHTQHKVTQYKAGKASLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLECTACKTKKQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.81
4 0.86
5 0.85
6 0.86
7 0.86
8 0.88
9 0.84
10 0.83
11 0.82
12 0.75
13 0.74
14 0.68
15 0.64
16 0.56
17 0.5
18 0.4
19 0.34
20 0.33
21 0.31
22 0.32
23 0.28
24 0.31
25 0.36
26 0.4
27 0.46
28 0.49
29 0.47
30 0.51
31 0.58
32 0.58
33 0.6
34 0.59
35 0.58
36 0.57
37 0.59
38 0.5
39 0.45
40 0.41
41 0.33
42 0.35
43 0.37
44 0.35
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.62
58 0.59
59 0.57
60 0.52
61 0.48
62 0.48
63 0.42
64 0.4
65 0.4
66 0.42
67 0.45
68 0.54
69 0.58
70 0.6
71 0.7
72 0.75
73 0.8
74 0.79
75 0.74
76 0.67
77 0.6
78 0.57
79 0.57
80 0.56
81 0.54
82 0.54
83 0.51
84 0.49
85 0.48
86 0.42