Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9R621

Protein Details
Accession A0A1L9R621    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-42TPYRCFSCSLRNQNQPNKSDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, mito_nucl 12, nucl 5.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
IPR004033  UbiE/COQ5_MeTrFase  
IPR023576  UbiE/COQ5_MeTrFase_CS  
Gene Ontology GO:0031314  C:extrinsic component of mitochondrial inner membrane  
GO:0043333  F:2-octaprenyl-6-methoxy-1,4-benzoquinone methylase activity  
GO:0032259  P:methylation  
GO:0006744  P:ubiquinone biosynthetic process  
Pfam View protein in Pfam  
PF01209  Ubie_methyltran  
PROSITE View protein in PROSITE  
PS51608  SAM_MT_UBIE  
PS01183  UBIE_1  
PS01184  UBIE_2  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MSSRLMWRSLHFSAKRRMAVPPTPYRCFSCSLRNQNQPNKSDEAERMTHFGFTNVRESDKESMVRSVFSSVASSYDAMNDFMSLGIHRLWKDHFVRSLNPGSALPSRDTDTTGKGWQILDIAGGTGDIAFRMLDHATNINNDHETKVTISDINPEMLAEGKKRSIDTPYYNTKRLSFVEANAQEMPHIADNSIDLYTVVFGIRNFTDKQAALEEAYRVLKPGGVFACMEFSKVDNEVFNAVYKRWSFSAIPLIGHLVAGDRDSYQYLVESIEQFPSQEEFRGMIQKAGFMIPGKGFENLTGGIAAIHKGIKPLQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.63
3 0.57
4 0.6
5 0.58
6 0.59
7 0.61
8 0.62
9 0.61
10 0.61
11 0.63
12 0.6
13 0.55
14 0.52
15 0.48
16 0.47
17 0.5
18 0.56
19 0.62
20 0.67
21 0.75
22 0.79
23 0.83
24 0.76
25 0.7
26 0.64
27 0.57
28 0.52
29 0.46
30 0.43
31 0.38
32 0.36
33 0.35
34 0.31
35 0.31
36 0.26
37 0.25
38 0.22
39 0.2
40 0.26
41 0.23
42 0.25
43 0.23
44 0.27
45 0.29
46 0.29
47 0.3
48 0.25
49 0.29
50 0.27
51 0.27
52 0.24
53 0.22
54 0.18
55 0.16
56 0.16
57 0.11
58 0.12
59 0.12
60 0.12
61 0.1
62 0.11
63 0.12
64 0.11
65 0.11
66 0.1
67 0.09
68 0.08
69 0.08
70 0.06
71 0.07
72 0.08
73 0.1
74 0.1
75 0.12
76 0.13
77 0.21
78 0.24
79 0.27
80 0.31
81 0.31
82 0.33
83 0.37
84 0.4
85 0.33
86 0.31
87 0.27
88 0.25
89 0.25
90 0.25
91 0.21
92 0.18
93 0.19
94 0.18
95 0.21
96 0.19
97 0.19
98 0.2
99 0.2
100 0.18
101 0.18
102 0.17
103 0.15
104 0.14
105 0.11
106 0.08
107 0.07
108 0.06
109 0.05
110 0.04
111 0.04
112 0.03
113 0.03
114 0.02
115 0.03
116 0.03
117 0.03
118 0.04
119 0.04
120 0.05
121 0.06
122 0.07
123 0.08
124 0.09
125 0.1
126 0.1
127 0.11
128 0.11
129 0.11
130 0.11
131 0.11
132 0.1
133 0.09
134 0.09
135 0.09
136 0.09
137 0.12
138 0.12
139 0.12
140 0.11
141 0.1
142 0.09
143 0.1
144 0.11
145 0.08
146 0.08
147 0.09
148 0.1
149 0.11
150 0.12
151 0.13
152 0.18
153 0.21
154 0.26
155 0.35
156 0.38
157 0.4
158 0.41
159 0.38
160 0.37
161 0.33
162 0.34
163 0.25
164 0.22
165 0.28
166 0.28
167 0.29
168 0.26
169 0.25
170 0.18
171 0.17
172 0.17
173 0.09
174 0.09
175 0.06
176 0.06
177 0.06
178 0.08
179 0.07
180 0.06
181 0.05
182 0.05
183 0.05
184 0.05
185 0.05
186 0.05
187 0.04
188 0.07
189 0.07
190 0.1
191 0.11
192 0.12
193 0.15
194 0.15
195 0.16
196 0.16
197 0.16
198 0.14
199 0.15
200 0.14
201 0.13
202 0.14
203 0.13
204 0.12
205 0.11
206 0.12
207 0.1
208 0.15
209 0.13
210 0.13
211 0.13
212 0.13
213 0.17
214 0.15
215 0.16
216 0.12
217 0.12
218 0.12
219 0.13
220 0.14
221 0.1
222 0.11
223 0.12
224 0.12
225 0.14
226 0.14
227 0.13
228 0.17
229 0.17
230 0.19
231 0.18
232 0.21
233 0.19
234 0.21
235 0.3
236 0.27
237 0.26
238 0.24
239 0.25
240 0.21
241 0.2
242 0.17
243 0.09
244 0.08
245 0.08
246 0.08
247 0.07
248 0.08
249 0.09
250 0.1
251 0.09
252 0.09
253 0.09
254 0.1
255 0.11
256 0.12
257 0.12
258 0.14
259 0.14
260 0.14
261 0.15
262 0.16
263 0.15
264 0.15
265 0.15
266 0.14
267 0.16
268 0.23
269 0.22
270 0.24
271 0.23
272 0.23
273 0.23
274 0.22
275 0.21
276 0.15
277 0.18
278 0.16
279 0.19
280 0.19
281 0.19
282 0.19
283 0.17
284 0.19
285 0.16
286 0.16
287 0.13
288 0.11
289 0.1
290 0.11
291 0.11
292 0.09
293 0.11
294 0.1
295 0.13