Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9R9G0

Protein Details
Accession A0A1L9R9G0   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-41LLWKIPWRISQPQKARQRKRLRSVDRVIDTHydrophilic
73-102DKYTIFDKKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
80-94KKEKKYRKGIHKLPK
Subcellular Location(s) mito 22.5, mito_nucl 13.333, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKPSSPLFSGLLWKIPWRISQPQKARQRKRLRSVDRVIDTVSAALQRNGQSTHSVERWFTEMPREEEMLPKDKYTIFDKKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.26
4 0.28
5 0.28
6 0.37
7 0.42
8 0.51
9 0.58
10 0.65
11 0.73
12 0.8
13 0.84
14 0.85
15 0.87
16 0.87
17 0.88
18 0.89
19 0.87
20 0.85
21 0.83
22 0.81
23 0.72
24 0.63
25 0.54
26 0.43
27 0.35
28 0.25
29 0.19
30 0.12
31 0.1
32 0.09
33 0.1
34 0.1
35 0.12
36 0.12
37 0.13
38 0.12
39 0.14
40 0.16
41 0.16
42 0.16
43 0.14
44 0.15
45 0.16
46 0.15
47 0.14
48 0.16
49 0.19
50 0.21
51 0.23
52 0.24
53 0.21
54 0.25
55 0.28
56 0.28
57 0.25
58 0.22
59 0.21
60 0.21
61 0.24
62 0.26
63 0.32
64 0.3
65 0.39
66 0.47
67 0.55
68 0.64
69 0.7
70 0.71
71 0.73
72 0.79
73 0.8
74 0.84
75 0.85
76 0.86
77 0.85
78 0.89
79 0.88
80 0.88
81 0.83
82 0.8
83 0.8
84 0.8
85 0.8
86 0.77
87 0.79