Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9RMZ1

Protein Details
Accession A0A1L9RMZ1   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
57-83IFRTYRFTGRSDRRKRKGYSKIRGACSHydrophilic
NLS Segment(s)
PositionSequence
69-74RRKRKG
Subcellular Location(s) cyto 12, nucl 9, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010730  HET  
Pfam View protein in Pfam  
PF06985  HET  
Amino Acid Sequences MRLIKANGVEADRFEVREFYDANIPPYAILSHTWGDDEVTLRDLEETNAKRREEYDIFRTYRFTGRSDRRKRKGYSKIRGACSIAKNDSFDYVWIDTCCIDKTSSAELSESINSMYRWYEEAEVCYVCLADVSSMGDFSNSRWFTRGWTLQELIAPLKVIFLDRNWKVLGTKESLQAKISDRTRIPVDILTGTGDLDRVPVAQRMAWAATRQTSRLEDRAYSLLGIFGINMPMLYGEGKMAFARLQEEIMKVYEDFTLFAWRSSDENHGGLLAISPDAFKDSSDFDLDYNPNDTVNPSWVLDGKGMHLELPFMPIGHGGLGVALIFCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.19
4 0.21
5 0.21
6 0.18
7 0.25
8 0.25
9 0.27
10 0.27
11 0.26
12 0.22
13 0.22
14 0.2
15 0.13
16 0.13
17 0.14
18 0.14
19 0.14
20 0.15
21 0.14
22 0.14
23 0.14
24 0.15
25 0.12
26 0.13
27 0.12
28 0.12
29 0.13
30 0.12
31 0.12
32 0.19
33 0.22
34 0.29
35 0.35
36 0.35
37 0.35
38 0.36
39 0.43
40 0.41
41 0.43
42 0.42
43 0.45
44 0.47
45 0.46
46 0.47
47 0.42
48 0.42
49 0.38
50 0.34
51 0.35
52 0.43
53 0.54
54 0.63
55 0.71
56 0.73
57 0.8
58 0.84
59 0.84
60 0.84
61 0.84
62 0.84
63 0.84
64 0.83
65 0.79
66 0.76
67 0.69
68 0.65
69 0.58
70 0.54
71 0.46
72 0.39
73 0.37
74 0.33
75 0.32
76 0.25
77 0.21
78 0.18
79 0.16
80 0.15
81 0.14
82 0.14
83 0.12
84 0.13
85 0.13
86 0.11
87 0.11
88 0.1
89 0.13
90 0.16
91 0.17
92 0.17
93 0.16
94 0.16
95 0.17
96 0.17
97 0.14
98 0.1
99 0.1
100 0.1
101 0.1
102 0.1
103 0.09
104 0.1
105 0.1
106 0.13
107 0.12
108 0.14
109 0.15
110 0.14
111 0.13
112 0.12
113 0.11
114 0.07
115 0.07
116 0.05
117 0.03
118 0.04
119 0.05
120 0.04
121 0.05
122 0.05
123 0.05
124 0.05
125 0.06
126 0.15
127 0.15
128 0.15
129 0.16
130 0.17
131 0.19
132 0.25
133 0.29
134 0.23
135 0.25
136 0.26
137 0.25
138 0.26
139 0.24
140 0.18
141 0.14
142 0.11
143 0.08
144 0.07
145 0.06
146 0.06
147 0.05
148 0.06
149 0.13
150 0.13
151 0.15
152 0.15
153 0.16
154 0.16
155 0.18
156 0.2
157 0.17
158 0.18
159 0.22
160 0.24
161 0.25
162 0.25
163 0.24
164 0.24
165 0.27
166 0.27
167 0.26
168 0.24
169 0.26
170 0.27
171 0.25
172 0.23
173 0.18
174 0.18
175 0.13
176 0.13
177 0.11
178 0.09
179 0.09
180 0.08
181 0.07
182 0.05
183 0.05
184 0.05
185 0.04
186 0.06
187 0.07
188 0.08
189 0.08
190 0.09
191 0.1
192 0.11
193 0.11
194 0.11
195 0.11
196 0.15
197 0.16
198 0.16
199 0.18
200 0.2
201 0.22
202 0.25
203 0.26
204 0.22
205 0.24
206 0.25
207 0.22
208 0.19
209 0.16
210 0.12
211 0.1
212 0.09
213 0.07
214 0.05
215 0.05
216 0.05
217 0.05
218 0.04
219 0.04
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.06
226 0.06
227 0.07
228 0.07
229 0.07
230 0.09
231 0.09
232 0.1
233 0.11
234 0.12
235 0.13
236 0.13
237 0.14
238 0.12
239 0.12
240 0.12
241 0.11
242 0.11
243 0.1
244 0.16
245 0.15
246 0.15
247 0.15
248 0.15
249 0.16
250 0.18
251 0.22
252 0.19
253 0.19
254 0.18
255 0.18
256 0.17
257 0.16
258 0.14
259 0.09
260 0.06
261 0.06
262 0.06
263 0.06
264 0.08
265 0.08
266 0.08
267 0.09
268 0.11
269 0.14
270 0.16
271 0.16
272 0.14
273 0.2
274 0.21
275 0.21
276 0.22
277 0.19
278 0.18
279 0.17
280 0.19
281 0.15
282 0.17
283 0.18
284 0.15
285 0.17
286 0.18
287 0.2
288 0.2
289 0.18
290 0.17
291 0.19
292 0.18
293 0.18
294 0.16
295 0.16
296 0.15
297 0.17
298 0.15
299 0.12
300 0.12
301 0.12
302 0.12
303 0.1
304 0.1
305 0.06
306 0.06
307 0.06
308 0.06