Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9RE61

Protein Details
Accession A0A1L9RE61    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
50-84AEARSVTPRSRRPRKAKKRENERKAKSIPHKRATHBasic
NLS Segment(s)
PositionSequence
50-81AEARSVTPRSRRPRKAKKRENERKAKSIPHKR
Subcellular Location(s) mito 13, nucl 10, extr 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASLSEGEKKKNVSQSFIGNIYFAFLFAFLLLYATLYAARDRHRGLDRGAEARSVTPRSRRPRKAKKRENERKAKSIPHKRATHVAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.45
4 0.43
5 0.37
6 0.28
7 0.26
8 0.22
9 0.18
10 0.12
11 0.08
12 0.06
13 0.05
14 0.05
15 0.06
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.05
24 0.06
25 0.07
26 0.09
27 0.12
28 0.12
29 0.18
30 0.2
31 0.22
32 0.22
33 0.26
34 0.26
35 0.26
36 0.26
37 0.22
38 0.19
39 0.19
40 0.21
41 0.19
42 0.19
43 0.24
44 0.32
45 0.42
46 0.52
47 0.61
48 0.69
49 0.77
50 0.86
51 0.91
52 0.92
53 0.93
54 0.94
55 0.95
56 0.95
57 0.94
58 0.91
59 0.89
60 0.84
61 0.84
62 0.83
63 0.83
64 0.82
65 0.81
66 0.79
67 0.74