Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VF79

Protein Details
Accession G0VF79    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-35NNNTKFNPSNKKPQQEPKVHHydrophilic
NLS Segment(s)
PositionSequence
181-191KKITRKKERPK
Subcellular Location(s) nucl 19, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR018809  DUF2406  
KEGG ncs:NCAS_0E00740  -  
Pfam View protein in Pfam  
PF10295  DUF2406  
Amino Acid Sequences MVYLRSILNKNNTTTNNNTKFNPSNKKPQQEPKVHEEEKLKFHTAVMKDSILDAVQEAQPFEEAVDSYFGFFEGQTFFRSDIDMHYKDIFGREIIERDRSNPTRPRDERPLDTIRGLEYQITGDKTWLTKLETEKFGFDVRPNFYNNIDTVLKENTISDNKQNKEVLEEKEEIGEPSNFWKKITRKKERPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.58
3 0.57
4 0.57
5 0.56
6 0.55
7 0.59
8 0.62
9 0.64
10 0.6
11 0.63
12 0.68
13 0.75
14 0.76
15 0.79
16 0.8
17 0.79
18 0.79
19 0.76
20 0.77
21 0.7
22 0.66
23 0.63
24 0.57
25 0.54
26 0.53
27 0.47
28 0.37
29 0.37
30 0.39
31 0.34
32 0.32
33 0.29
34 0.24
35 0.22
36 0.22
37 0.21
38 0.14
39 0.12
40 0.09
41 0.08
42 0.09
43 0.09
44 0.09
45 0.08
46 0.08
47 0.08
48 0.08
49 0.07
50 0.05
51 0.05
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.1
66 0.11
67 0.1
68 0.12
69 0.18
70 0.17
71 0.18
72 0.18
73 0.18
74 0.18
75 0.19
76 0.16
77 0.09
78 0.1
79 0.09
80 0.11
81 0.12
82 0.16
83 0.15
84 0.17
85 0.24
86 0.24
87 0.3
88 0.35
89 0.38
90 0.44
91 0.47
92 0.51
93 0.53
94 0.56
95 0.53
96 0.53
97 0.53
98 0.44
99 0.42
100 0.36
101 0.28
102 0.24
103 0.21
104 0.14
105 0.1
106 0.09
107 0.11
108 0.12
109 0.11
110 0.1
111 0.11
112 0.11
113 0.12
114 0.13
115 0.12
116 0.15
117 0.2
118 0.25
119 0.28
120 0.29
121 0.29
122 0.28
123 0.28
124 0.26
125 0.24
126 0.23
127 0.23
128 0.24
129 0.26
130 0.26
131 0.26
132 0.27
133 0.24
134 0.24
135 0.21
136 0.19
137 0.19
138 0.19
139 0.18
140 0.16
141 0.17
142 0.16
143 0.2
144 0.22
145 0.29
146 0.36
147 0.38
148 0.43
149 0.44
150 0.39
151 0.42
152 0.45
153 0.4
154 0.37
155 0.37
156 0.32
157 0.33
158 0.34
159 0.28
160 0.25
161 0.21
162 0.16
163 0.22
164 0.3
165 0.28
166 0.28
167 0.36
168 0.42
169 0.52
170 0.63
171 0.66