Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9RMD5

Protein Details
Accession A0A1L9RMD5    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-36GRLRKKIQDRLAQRARRKRIABasic
NLS Segment(s)
PositionSequence
19-35RKKIQDRLAQRARRKRI
Subcellular Location(s) nucl 21, mito_nucl 12.333, cyto_nucl 11.833, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021833  DUF3425  
Pfam View protein in Pfam  
PF11905  DUF3425  
Amino Acid Sequences MDRDRDRDNWQGVQDGRLRKKIQDRLAQRARRKRIAESKASSSPSSDKIPPSLTLNQVLIPTTTTTPIIGQVPLTVWAALWQNGAMMEISCSVCIPSVSKPVDATIIPASLHPTDLQLTTIHHSWIDRFPFPKMRDNMTTLTSVIDENEFLQDLFCMTSFTIETGAASWDANAWKIGREFEMKWGYLFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.47
4 0.5
5 0.51
6 0.51
7 0.6
8 0.63
9 0.65
10 0.66
11 0.66
12 0.69
13 0.78
14 0.8
15 0.8
16 0.81
17 0.8
18 0.79
19 0.76
20 0.75
21 0.75
22 0.74
23 0.74
24 0.7
25 0.68
26 0.65
27 0.65
28 0.55
29 0.48
30 0.43
31 0.37
32 0.36
33 0.32
34 0.27
35 0.27
36 0.29
37 0.28
38 0.3
39 0.3
40 0.28
41 0.27
42 0.26
43 0.24
44 0.22
45 0.21
46 0.16
47 0.13
48 0.12
49 0.1
50 0.1
51 0.09
52 0.09
53 0.09
54 0.1
55 0.1
56 0.09
57 0.08
58 0.08
59 0.08
60 0.09
61 0.09
62 0.07
63 0.06
64 0.08
65 0.09
66 0.09
67 0.09
68 0.07
69 0.07
70 0.07
71 0.07
72 0.05
73 0.04
74 0.04
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.06
83 0.06
84 0.13
85 0.14
86 0.14
87 0.15
88 0.15
89 0.16
90 0.15
91 0.16
92 0.1
93 0.1
94 0.09
95 0.09
96 0.11
97 0.1
98 0.1
99 0.08
100 0.09
101 0.09
102 0.09
103 0.1
104 0.08
105 0.09
106 0.12
107 0.12
108 0.11
109 0.11
110 0.11
111 0.12
112 0.17
113 0.19
114 0.19
115 0.2
116 0.24
117 0.32
118 0.35
119 0.41
120 0.39
121 0.41
122 0.42
123 0.45
124 0.43
125 0.37
126 0.35
127 0.26
128 0.24
129 0.19
130 0.15
131 0.12
132 0.1
133 0.08
134 0.08
135 0.08
136 0.08
137 0.07
138 0.07
139 0.07
140 0.07
141 0.07
142 0.06
143 0.06
144 0.06
145 0.08
146 0.08
147 0.08
148 0.09
149 0.08
150 0.08
151 0.08
152 0.1
153 0.09
154 0.08
155 0.08
156 0.09
157 0.1
158 0.11
159 0.12
160 0.12
161 0.15
162 0.16
163 0.18
164 0.19
165 0.23
166 0.24
167 0.31
168 0.36
169 0.33