Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9RK34

Protein Details
Accession A0A1L9RK34   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
143-164DLDNRRQQRQRRLDQLRRLQGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 6, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR025207  Sim4_Fta4  
Gene Ontology GO:0031511  C:Mis6-Sim4 complex  
Pfam View protein in Pfam  
PF13093  FTA4  
Amino Acid Sequences MDSTRTIPELKSAFIRAQVRVLSESLQPADNWRDYATQPSEEDLSDKVVEDVIQKLNTALKQHNRIVYSSQAIHHVAQQIASLYWSSVHHETRSLGSYDRGVEKTVDLSNHMNLTKLPVELEVHSATEEECQRYLRLRERLVDLDNRRQQRQRRLDQLRRLQGLLKPFHEPQKNIQPNLITRDGELVQELDKMRMLVARVGGRIGQKKRTSDGQEKEASYELGSDNKLAELLDMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.3
4 0.33
5 0.32
6 0.31
7 0.3
8 0.29
9 0.24
10 0.22
11 0.24
12 0.21
13 0.2
14 0.18
15 0.2
16 0.25
17 0.24
18 0.23
19 0.22
20 0.23
21 0.23
22 0.3
23 0.29
24 0.27
25 0.26
26 0.27
27 0.26
28 0.23
29 0.24
30 0.17
31 0.17
32 0.14
33 0.14
34 0.12
35 0.11
36 0.11
37 0.11
38 0.14
39 0.14
40 0.14
41 0.14
42 0.14
43 0.17
44 0.19
45 0.21
46 0.25
47 0.29
48 0.35
49 0.39
50 0.43
51 0.41
52 0.4
53 0.39
54 0.36
55 0.32
56 0.27
57 0.24
58 0.23
59 0.23
60 0.22
61 0.22
62 0.21
63 0.18
64 0.16
65 0.16
66 0.13
67 0.11
68 0.11
69 0.09
70 0.06
71 0.07
72 0.07
73 0.1
74 0.13
75 0.14
76 0.15
77 0.16
78 0.17
79 0.17
80 0.19
81 0.16
82 0.14
83 0.13
84 0.14
85 0.14
86 0.17
87 0.15
88 0.14
89 0.13
90 0.13
91 0.14
92 0.14
93 0.13
94 0.12
95 0.13
96 0.13
97 0.15
98 0.14
99 0.12
100 0.11
101 0.14
102 0.12
103 0.11
104 0.1
105 0.09
106 0.1
107 0.1
108 0.13
109 0.1
110 0.09
111 0.09
112 0.09
113 0.08
114 0.1
115 0.11
116 0.1
117 0.1
118 0.11
119 0.11
120 0.15
121 0.19
122 0.24
123 0.28
124 0.29
125 0.31
126 0.34
127 0.36
128 0.36
129 0.4
130 0.36
131 0.4
132 0.44
133 0.45
134 0.46
135 0.5
136 0.55
137 0.57
138 0.63
139 0.62
140 0.66
141 0.73
142 0.78
143 0.81
144 0.83
145 0.8
146 0.72
147 0.65
148 0.58
149 0.49
150 0.48
151 0.42
152 0.34
153 0.31
154 0.32
155 0.39
156 0.41
157 0.41
158 0.4
159 0.48
160 0.52
161 0.49
162 0.49
163 0.45
164 0.43
165 0.47
166 0.44
167 0.32
168 0.26
169 0.29
170 0.27
171 0.23
172 0.2
173 0.15
174 0.11
175 0.15
176 0.15
177 0.12
178 0.12
179 0.12
180 0.12
181 0.13
182 0.14
183 0.12
184 0.16
185 0.18
186 0.18
187 0.19
188 0.21
189 0.25
190 0.33
191 0.35
192 0.4
193 0.43
194 0.46
195 0.5
196 0.56
197 0.59
198 0.6
199 0.62
200 0.61
201 0.62
202 0.59
203 0.57
204 0.5
205 0.42
206 0.32
207 0.27
208 0.21
209 0.18
210 0.18
211 0.16
212 0.15
213 0.14
214 0.14
215 0.12