Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9RG61

Protein Details
Accession A0A1L9RG61    Localization Confidence High Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
93-117NTDRQLRQRGQKRGKKRKPPTVDIGBasic
136-161IQYKEPSLSPKRPRRRGERPNEDGTSHydrophilic
NLS Segment(s)
PositionSequence
100-111QRGQKRGKKRKP
145-152PKRPRRRG
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MENLNSTEQSQSAHNAATGNVDGPQAHREQTASQDSGYEGDVEVVKPYAIEEPDDHSTSKPETSTTSYHPRNSGQWQSDLVESMGDLQCESDNTDRQLRQRGQKRGKKRKPPTVDIGASAYAQSQKPENASKLGDIQYKEPSLSPKRPRRRGERPNEDGTSSHLSSGTGSSVSSSSGSQSPESNSTGAVGGTPAADAMDID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.15
4 0.17
5 0.16
6 0.13
7 0.12
8 0.12
9 0.11
10 0.12
11 0.15
12 0.14
13 0.15
14 0.15
15 0.15
16 0.16
17 0.22
18 0.27
19 0.24
20 0.23
21 0.22
22 0.22
23 0.21
24 0.2
25 0.14
26 0.08
27 0.09
28 0.09
29 0.09
30 0.09
31 0.08
32 0.08
33 0.07
34 0.08
35 0.09
36 0.09
37 0.11
38 0.11
39 0.16
40 0.2
41 0.21
42 0.21
43 0.18
44 0.2
45 0.2
46 0.2
47 0.16
48 0.13
49 0.15
50 0.18
51 0.21
52 0.24
53 0.32
54 0.35
55 0.37
56 0.38
57 0.37
58 0.37
59 0.41
60 0.42
61 0.35
62 0.33
63 0.32
64 0.31
65 0.29
66 0.26
67 0.19
68 0.12
69 0.09
70 0.11
71 0.09
72 0.08
73 0.07
74 0.07
75 0.07
76 0.07
77 0.09
78 0.08
79 0.1
80 0.12
81 0.16
82 0.18
83 0.2
84 0.28
85 0.3
86 0.37
87 0.44
88 0.52
89 0.58
90 0.64
91 0.74
92 0.77
93 0.83
94 0.85
95 0.86
96 0.86
97 0.84
98 0.83
99 0.78
100 0.75
101 0.66
102 0.56
103 0.49
104 0.39
105 0.3
106 0.24
107 0.18
108 0.12
109 0.11
110 0.1
111 0.1
112 0.11
113 0.14
114 0.17
115 0.18
116 0.19
117 0.19
118 0.19
119 0.22
120 0.24
121 0.25
122 0.23
123 0.23
124 0.25
125 0.25
126 0.24
127 0.21
128 0.25
129 0.29
130 0.37
131 0.45
132 0.52
133 0.62
134 0.71
135 0.79
136 0.81
137 0.85
138 0.87
139 0.88
140 0.88
141 0.84
142 0.82
143 0.76
144 0.68
145 0.57
146 0.51
147 0.47
148 0.36
149 0.3
150 0.22
151 0.2
152 0.19
153 0.19
154 0.15
155 0.08
156 0.08
157 0.09
158 0.09
159 0.09
160 0.1
161 0.09
162 0.1
163 0.13
164 0.15
165 0.15
166 0.17
167 0.2
168 0.23
169 0.25
170 0.22
171 0.2
172 0.19
173 0.18
174 0.16
175 0.12
176 0.09
177 0.07
178 0.07
179 0.07
180 0.06
181 0.05