Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9RZE4

Protein Details
Accession A0A1L9RZE4   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-31MRKGTRSCVACRRRKVRCSYASSEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MARAKKQMRKGTRSCVACRRRKVRCSYASSEASVCVHCARRKSVCVPQGDVQVECEYKDSQDPEVRPVGVLSDDGVSFFDALDGLRRRVAVSLGSPRSSSRDGQSNGCTWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.75
3 0.75
4 0.74
5 0.77
6 0.77
7 0.78
8 0.81
9 0.83
10 0.82
11 0.81
12 0.8
13 0.76
14 0.74
15 0.67
16 0.6
17 0.51
18 0.42
19 0.33
20 0.25
21 0.2
22 0.15
23 0.18
24 0.19
25 0.21
26 0.25
27 0.28
28 0.31
29 0.36
30 0.41
31 0.4
32 0.41
33 0.42
34 0.4
35 0.42
36 0.39
37 0.33
38 0.27
39 0.23
40 0.21
41 0.17
42 0.16
43 0.1
44 0.09
45 0.11
46 0.11
47 0.12
48 0.16
49 0.17
50 0.18
51 0.2
52 0.19
53 0.17
54 0.16
55 0.14
56 0.1
57 0.1
58 0.07
59 0.06
60 0.06
61 0.06
62 0.07
63 0.06
64 0.06
65 0.06
66 0.05
67 0.04
68 0.04
69 0.11
70 0.13
71 0.14
72 0.15
73 0.15
74 0.16
75 0.17
76 0.18
77 0.14
78 0.17
79 0.25
80 0.28
81 0.29
82 0.3
83 0.3
84 0.34
85 0.35
86 0.33
87 0.29
88 0.34
89 0.36
90 0.41
91 0.44