Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9R9Y8

Protein Details
Accession A0A1L9R9Y8    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-42VNVPKTRRTYCKSKECHKHTQHKVTQYKHydrophilic
86-105ECTACKTKKQLALKRCKHFEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MKLHSIPLLLLSKIVNVPKTRRTYCKSKECHKHTQHKVTQYKAGKASLAAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKIVLRLECTACKTKKQLALKRCKHFELGGDKKTKGAALTVRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.24
4 0.29
5 0.36
6 0.45
7 0.48
8 0.53
9 0.57
10 0.63
11 0.68
12 0.73
13 0.73
14 0.75
15 0.8
16 0.79
17 0.84
18 0.83
19 0.84
20 0.84
21 0.86
22 0.82
23 0.81
24 0.8
25 0.72
26 0.71
27 0.65
28 0.6
29 0.52
30 0.46
31 0.36
32 0.31
33 0.3
34 0.28
35 0.29
36 0.25
37 0.28
38 0.33
39 0.37
40 0.42
41 0.45
42 0.44
43 0.48
44 0.55
45 0.55
46 0.57
47 0.56
48 0.55
49 0.54
50 0.57
51 0.48
52 0.43
53 0.4
54 0.33
55 0.35
56 0.37
57 0.37
58 0.31
59 0.38
60 0.43
61 0.51
62 0.6
63 0.63
64 0.62
65 0.66
66 0.73
67 0.73
68 0.72
69 0.68
70 0.63
71 0.61
72 0.59
73 0.53
74 0.49
75 0.49
76 0.43
77 0.41
78 0.41
79 0.43
80 0.46
81 0.54
82 0.59
83 0.61
84 0.7
85 0.75
86 0.8
87 0.79
88 0.74
89 0.67
90 0.6
91 0.57
92 0.57
93 0.56
94 0.54
95 0.54
96 0.51
97 0.49
98 0.48
99 0.42
100 0.32
101 0.29