Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VEQ6

Protein Details
Accession G0VEQ6    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MQREKVIYYHQRRTRQKMVKQVPYLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024242  NCE101  
Gene Ontology GO:0016020  C:membrane  
GO:0009306  P:protein secretion  
KEGG ncs:NCAS_0D04660  -  
Pfam View protein in Pfam  
PF11654  NCE101  
Amino Acid Sequences MQREKVIYYHQRRTRQKMVKQVPYLLGRFMDPLLAIVIGTTSYYLYETRTTRDQPTRRSLLHLLERNYSGSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.79
4 0.8
5 0.81
6 0.8
7 0.75
8 0.7
9 0.65
10 0.59
11 0.53
12 0.42
13 0.33
14 0.24
15 0.21
16 0.17
17 0.12
18 0.07
19 0.07
20 0.06
21 0.05
22 0.05
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.04
31 0.05
32 0.06
33 0.11
34 0.12
35 0.15
36 0.2
37 0.23
38 0.3
39 0.39
40 0.44
41 0.47
42 0.55
43 0.58
44 0.54
45 0.57
46 0.54
47 0.52
48 0.56
49 0.56
50 0.5
51 0.48
52 0.49