Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9S299

Protein Details
Accession A0A1L9S299    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23QGKRKKSSRQPQGPRKREPLPSTBasic
NLS Segment(s)
PositionSequence
3-17KRKKSSRQPQGPRKR
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences QGKRKKSSRQPQGPRKREPLPSTFACLFCNHENSIVVKLDKKLGLGNLSCKVCGQRFQTGINYLSAAVDVYSDWVDACDAVAKDAANKYEENDSRGMRSQDYPSLEQPDVSERMNAYTEDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.87
3 0.83
4 0.81
5 0.76
6 0.71
7 0.67
8 0.6
9 0.58
10 0.54
11 0.47
12 0.39
13 0.34
14 0.33
15 0.29
16 0.3
17 0.24
18 0.22
19 0.23
20 0.22
21 0.24
22 0.22
23 0.19
24 0.18
25 0.19
26 0.21
27 0.19
28 0.19
29 0.17
30 0.16
31 0.19
32 0.18
33 0.2
34 0.22
35 0.22
36 0.22
37 0.2
38 0.21
39 0.19
40 0.23
41 0.23
42 0.23
43 0.24
44 0.26
45 0.28
46 0.28
47 0.28
48 0.23
49 0.19
50 0.14
51 0.12
52 0.1
53 0.07
54 0.05
55 0.04
56 0.03
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.07
66 0.06
67 0.07
68 0.08
69 0.08
70 0.1
71 0.12
72 0.14
73 0.12
74 0.12
75 0.14
76 0.22
77 0.23
78 0.24
79 0.26
80 0.26
81 0.27
82 0.32
83 0.32
84 0.26
85 0.28
86 0.29
87 0.31
88 0.35
89 0.35
90 0.34
91 0.39
92 0.36
93 0.33
94 0.31
95 0.3
96 0.28
97 0.25
98 0.24
99 0.18
100 0.21
101 0.22