Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9RRS9

Protein Details
Accession A0A1L9RRS9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VLAKKHVPIVKKRTKRFERHQSDRFKCVPSAWRKPKGIDNRVRRRFRGBasic
NLS Segment(s)
PositionSequence
11-20VKKRTKRFER
33-47WRKPKGIDNRVRRRF
Subcellular Location(s) mito 17, cyto 6, cyto_nucl 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVLAKKHVPIVKKRTKRFERHQSDRFKCVPSAWRKPKGIDNRVRRRFRGNIAMPSIGYGSNKKTKHMAPSGHKAFLVQNPKDVELLLMHNRTYAAEIGHAVSSRKRVDIIAKAKALGVKVTNPKGRVQVEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.87
4 0.88
5 0.89
6 0.89
7 0.89
8 0.88
9 0.88
10 0.83
11 0.81
12 0.73
13 0.65
14 0.56
15 0.5
16 0.51
17 0.49
18 0.55
19 0.57
20 0.62
21 0.61
22 0.63
23 0.68
24 0.69
25 0.7
26 0.68
27 0.7
28 0.72
29 0.8
30 0.82
31 0.75
32 0.72
33 0.67
34 0.63
35 0.62
36 0.56
37 0.52
38 0.5
39 0.48
40 0.41
41 0.36
42 0.31
43 0.21
44 0.16
45 0.12
46 0.12
47 0.19
48 0.2
49 0.2
50 0.23
51 0.25
52 0.31
53 0.35
54 0.38
55 0.37
56 0.46
57 0.48
58 0.45
59 0.43
60 0.37
61 0.33
62 0.32
63 0.35
64 0.25
65 0.27
66 0.27
67 0.28
68 0.27
69 0.25
70 0.2
71 0.13
72 0.16
73 0.16
74 0.16
75 0.15
76 0.15
77 0.15
78 0.15
79 0.15
80 0.12
81 0.08
82 0.08
83 0.09
84 0.1
85 0.11
86 0.11
87 0.11
88 0.12
89 0.17
90 0.18
91 0.18
92 0.18
93 0.19
94 0.24
95 0.33
96 0.37
97 0.39
98 0.39
99 0.39
100 0.39
101 0.39
102 0.34
103 0.28
104 0.23
105 0.24
106 0.31
107 0.39
108 0.43
109 0.43
110 0.46
111 0.51