Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9RRH4

Protein Details
Accession A0A1L9RRH4   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
217-238VLERRDVEKRKRLDRLEKAMARBasic
NLS Segment(s)
PositionSequence
225-229KRKRL
Subcellular Location(s) nucl 16, mito 8, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR040351  RAB3IL/RAB3IP/Sec2  
IPR009449  Sec2_N  
Gene Ontology GO:0005085  F:guanyl-nucleotide exchange factor activity  
Pfam View protein in Pfam  
PF06428  Sec2p  
Amino Acid Sequences MSTTTTTALTATTLVGMLPAMSTTSDKTCPTCGQEGFPSQQHSAEEAQQRIKELEGQVLDLNSQVALTAEKLALYEDELRRLRAPTTPRKGSPISSLSSNRSNDLSPTQLPPSSSPQSQPQQSRLSTFTSFLPYRRPSATPPVPSPPQAPVIPVQEDTLELQNALSREQDLRKAAETQLSQASTELEDLTAQLFSQANEMVAEERRARAKLEERVAVLERRDVEKRKRLDRLEKAMARVERVRALVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.05
5 0.05
6 0.04
7 0.05
8 0.06
9 0.07
10 0.09
11 0.13
12 0.16
13 0.18
14 0.2
15 0.24
16 0.26
17 0.3
18 0.34
19 0.32
20 0.33
21 0.36
22 0.39
23 0.39
24 0.39
25 0.38
26 0.33
27 0.34
28 0.3
29 0.28
30 0.26
31 0.28
32 0.31
33 0.3
34 0.34
35 0.32
36 0.33
37 0.31
38 0.29
39 0.27
40 0.22
41 0.24
42 0.19
43 0.2
44 0.19
45 0.18
46 0.18
47 0.13
48 0.12
49 0.07
50 0.06
51 0.05
52 0.04
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.06
59 0.07
60 0.06
61 0.08
62 0.14
63 0.13
64 0.21
65 0.22
66 0.23
67 0.24
68 0.25
69 0.24
70 0.23
71 0.3
72 0.34
73 0.42
74 0.46
75 0.46
76 0.5
77 0.51
78 0.47
79 0.45
80 0.38
81 0.31
82 0.3
83 0.32
84 0.3
85 0.34
86 0.33
87 0.28
88 0.26
89 0.25
90 0.22
91 0.21
92 0.2
93 0.15
94 0.17
95 0.17
96 0.17
97 0.18
98 0.18
99 0.23
100 0.23
101 0.22
102 0.22
103 0.27
104 0.31
105 0.35
106 0.35
107 0.34
108 0.36
109 0.36
110 0.36
111 0.31
112 0.3
113 0.26
114 0.24
115 0.2
116 0.2
117 0.2
118 0.19
119 0.24
120 0.22
121 0.24
122 0.25
123 0.26
124 0.24
125 0.32
126 0.38
127 0.35
128 0.37
129 0.4
130 0.39
131 0.39
132 0.37
133 0.3
134 0.28
135 0.24
136 0.22
137 0.19
138 0.21
139 0.21
140 0.19
141 0.18
142 0.14
143 0.14
144 0.14
145 0.13
146 0.1
147 0.08
148 0.08
149 0.09
150 0.09
151 0.09
152 0.08
153 0.08
154 0.11
155 0.13
156 0.17
157 0.18
158 0.19
159 0.2
160 0.22
161 0.22
162 0.25
163 0.23
164 0.22
165 0.24
166 0.23
167 0.21
168 0.19
169 0.19
170 0.14
171 0.14
172 0.11
173 0.07
174 0.07
175 0.07
176 0.07
177 0.06
178 0.05
179 0.07
180 0.07
181 0.07
182 0.09
183 0.09
184 0.09
185 0.09
186 0.1
187 0.1
188 0.11
189 0.14
190 0.14
191 0.16
192 0.19
193 0.2
194 0.21
195 0.26
196 0.33
197 0.38
198 0.43
199 0.44
200 0.42
201 0.45
202 0.47
203 0.43
204 0.36
205 0.32
206 0.29
207 0.3
208 0.36
209 0.4
210 0.46
211 0.51
212 0.59
213 0.64
214 0.7
215 0.75
216 0.78
217 0.81
218 0.81
219 0.83
220 0.79
221 0.73
222 0.72
223 0.64
224 0.59
225 0.54
226 0.48
227 0.42