Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9RRH1

Protein Details
Accession A0A1L9RRH1   
Localization Confidence High
Confidence Score 22.8
NoLS Segment(s)
PositionSequenceProtein Nature
28-62VRDPNAVKTKAKKHTKPKPPPKATAKQPESRPKKABasic
81-109RQQPSQPSKPDEPKNKKRKRDAGDASNAKHydrophilic
248-271KERDPWAKLNKKERANKQTNPFDVHydrophilic
NLS Segment(s)
PositionSequence
35-62KTKAKKHTKPKPPPKATAKQPESRPKKA
90-113PDEPKNKKRKRDAGDASNAKKKKS
172-201PKIREERRTKHEKHLRRLQRMWREDDKKIR
233-262RAKKKGGAKKGDAGVKERDPWAKLNKKERA
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038871  C607.02c-like  
Amino Acid Sequences MPHKHKRRGNDASTYDLPPTQIAKSLPVRDPNAVKTKAKKHTKPKPPPKATAKQPESRPKKALEDDTPRAFRRLMQFQQARQQPSQPSKPDEPKNKKRKRDAGDASNAKKKKSTAASNDAPAPAPAPAPAEPKSTLSILPGEKLSDFAARVDREMPLSAMKKSGKVNDPNMPKIREERRTKHEKHLRRLQRMWREDDKKIREREAAEREERQDEMEDQLELWKEWETEAAQARAKKKGGAKKGDAGVKERDPWAKLNKKERANKQTNPFDVVQAPPELKKPKAPFKVHGGAKIDVANVPTAVGSLRRREELADERRNIVEEYRRLMAEKRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.53
3 0.44
4 0.37
5 0.29
6 0.28
7 0.21
8 0.21
9 0.2
10 0.25
11 0.31
12 0.37
13 0.4
14 0.45
15 0.48
16 0.49
17 0.53
18 0.53
19 0.55
20 0.54
21 0.55
22 0.56
23 0.63
24 0.67
25 0.73
26 0.75
27 0.77
28 0.82
29 0.88
30 0.9
31 0.92
32 0.93
33 0.91
34 0.91
35 0.9
36 0.89
37 0.88
38 0.88
39 0.84
40 0.81
41 0.82
42 0.82
43 0.81
44 0.78
45 0.73
46 0.66
47 0.66
48 0.65
49 0.63
50 0.61
51 0.62
52 0.62
53 0.65
54 0.66
55 0.59
56 0.54
57 0.47
58 0.41
59 0.4
60 0.43
61 0.39
62 0.44
63 0.48
64 0.49
65 0.58
66 0.6
67 0.57
68 0.5
69 0.51
70 0.49
71 0.52
72 0.56
73 0.53
74 0.53
75 0.56
76 0.64
77 0.68
78 0.71
79 0.73
80 0.76
81 0.82
82 0.85
83 0.87
84 0.88
85 0.89
86 0.85
87 0.85
88 0.83
89 0.8
90 0.81
91 0.8
92 0.74
93 0.73
94 0.67
95 0.56
96 0.51
97 0.42
98 0.4
99 0.4
100 0.43
101 0.43
102 0.5
103 0.52
104 0.52
105 0.53
106 0.46
107 0.38
108 0.29
109 0.22
110 0.14
111 0.11
112 0.09
113 0.09
114 0.1
115 0.13
116 0.15
117 0.17
118 0.18
119 0.19
120 0.2
121 0.19
122 0.17
123 0.15
124 0.17
125 0.14
126 0.14
127 0.13
128 0.12
129 0.11
130 0.12
131 0.12
132 0.09
133 0.09
134 0.09
135 0.13
136 0.13
137 0.13
138 0.13
139 0.13
140 0.12
141 0.12
142 0.12
143 0.12
144 0.13
145 0.12
146 0.16
147 0.16
148 0.19
149 0.2
150 0.25
151 0.27
152 0.31
153 0.35
154 0.38
155 0.42
156 0.45
157 0.47
158 0.43
159 0.38
160 0.4
161 0.43
162 0.45
163 0.48
164 0.49
165 0.53
166 0.61
167 0.64
168 0.68
169 0.71
170 0.7
171 0.72
172 0.76
173 0.77
174 0.75
175 0.79
176 0.77
177 0.78
178 0.74
179 0.71
180 0.7
181 0.66
182 0.64
183 0.66
184 0.65
185 0.62
186 0.61
187 0.57
188 0.51
189 0.49
190 0.52
191 0.5
192 0.48
193 0.44
194 0.44
195 0.43
196 0.41
197 0.38
198 0.3
199 0.24
200 0.19
201 0.18
202 0.15
203 0.13
204 0.11
205 0.13
206 0.12
207 0.11
208 0.1
209 0.09
210 0.08
211 0.08
212 0.1
213 0.09
214 0.12
215 0.16
216 0.18
217 0.2
218 0.24
219 0.27
220 0.31
221 0.31
222 0.31
223 0.36
224 0.42
225 0.48
226 0.52
227 0.54
228 0.55
229 0.6
230 0.6
231 0.54
232 0.5
233 0.46
234 0.4
235 0.39
236 0.36
237 0.33
238 0.31
239 0.34
240 0.41
241 0.44
242 0.49
243 0.56
244 0.61
245 0.67
246 0.75
247 0.8
248 0.81
249 0.81
250 0.81
251 0.81
252 0.82
253 0.75
254 0.71
255 0.61
256 0.53
257 0.46
258 0.4
259 0.32
260 0.25
261 0.24
262 0.2
263 0.27
264 0.29
265 0.28
266 0.35
267 0.41
268 0.48
269 0.57
270 0.62
271 0.6
272 0.65
273 0.72
274 0.67
275 0.66
276 0.61
277 0.52
278 0.48
279 0.44
280 0.36
281 0.27
282 0.25
283 0.19
284 0.14
285 0.13
286 0.1
287 0.09
288 0.09
289 0.13
290 0.16
291 0.22
292 0.26
293 0.28
294 0.29
295 0.3
296 0.37
297 0.41
298 0.47
299 0.5
300 0.49
301 0.5
302 0.5
303 0.51
304 0.45
305 0.4
306 0.39
307 0.34
308 0.37
309 0.37
310 0.37
311 0.37