Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9S1M0

Protein Details
Accession A0A1L9S1M0   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-112KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, cyto_mito 9.833, nucl 7.5, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MLSFRSVLGASTGTLRQFLPSLSRQSFARSFSQLSRLSLTNGLRSLRSRNDSTDNARIASVGSAVRQLEQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.13
5 0.14
6 0.16
7 0.19
8 0.26
9 0.26
10 0.28
11 0.27
12 0.32
13 0.34
14 0.32
15 0.32
16 0.27
17 0.28
18 0.28
19 0.35
20 0.31
21 0.3
22 0.29
23 0.26
24 0.25
25 0.27
26 0.26
27 0.22
28 0.22
29 0.21
30 0.19
31 0.2
32 0.23
33 0.23
34 0.27
35 0.25
36 0.26
37 0.31
38 0.33
39 0.36
40 0.38
41 0.33
42 0.29
43 0.27
44 0.24
45 0.19
46 0.16
47 0.12
48 0.06
49 0.06
50 0.07
51 0.07
52 0.08
53 0.09
54 0.1
55 0.1
56 0.14
57 0.17
58 0.17
59 0.19
60 0.2
61 0.2
62 0.23
63 0.31
64 0.33
65 0.38
66 0.4
67 0.41
68 0.49
69 0.51
70 0.51
71 0.5
72 0.52
73 0.54
74 0.6
75 0.65
76 0.66
77 0.73
78 0.78
79 0.77
80 0.79
81 0.8
82 0.79
83 0.78
84 0.78
85 0.76
86 0.77
87 0.79
88 0.75
89 0.75
90 0.77
91 0.81
92 0.82