Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9RQB3

Protein Details
Accession A0A1L9RQB3    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
161-186SSASHDKRPTNRRRHHLLRKLPPSTGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR011021  Arrestin-like_N  
IPR014756  Ig_E-set  
Pfam View protein in Pfam  
PF00339  Arrestin_N  
CDD cd22952  ART10-like  
Amino Acid Sequences MLSRVERFLDSPSRIDLRVQLDREQAVYTNEDAVSGHIILRNEAQVDVAAITVTLSGSATSRLRSGKLTESHQVTILNSFKGPLVFDSARQLFKRVEQVFPLNPGSSWFTNSRAMSLGPGEYTFSFSIRVCTAPLTICLGSVYLTSGIFQFPQVSECYKGSSASHDKRPTNRRRHHLLRKLPPSTGDSSTPGEIKYLLEATVRQDSLLSGTQKVVESPVPSIARVSFSAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.34
4 0.33
5 0.38
6 0.39
7 0.37
8 0.38
9 0.39
10 0.38
11 0.34
12 0.28
13 0.22
14 0.22
15 0.19
16 0.17
17 0.16
18 0.15
19 0.14
20 0.13
21 0.13
22 0.11
23 0.11
24 0.11
25 0.12
26 0.13
27 0.14
28 0.14
29 0.13
30 0.12
31 0.12
32 0.09
33 0.1
34 0.09
35 0.07
36 0.06
37 0.05
38 0.05
39 0.04
40 0.04
41 0.03
42 0.03
43 0.04
44 0.04
45 0.08
46 0.08
47 0.09
48 0.12
49 0.14
50 0.15
51 0.17
52 0.19
53 0.24
54 0.27
55 0.3
56 0.33
57 0.36
58 0.35
59 0.34
60 0.32
61 0.25
62 0.26
63 0.24
64 0.18
65 0.15
66 0.14
67 0.13
68 0.13
69 0.13
70 0.09
71 0.13
72 0.13
73 0.14
74 0.19
75 0.21
76 0.24
77 0.24
78 0.26
79 0.2
80 0.22
81 0.31
82 0.26
83 0.25
84 0.24
85 0.28
86 0.26
87 0.29
88 0.28
89 0.19
90 0.17
91 0.17
92 0.18
93 0.15
94 0.17
95 0.15
96 0.16
97 0.2
98 0.2
99 0.2
100 0.17
101 0.16
102 0.14
103 0.13
104 0.11
105 0.07
106 0.07
107 0.07
108 0.06
109 0.09
110 0.09
111 0.08
112 0.1
113 0.09
114 0.11
115 0.11
116 0.11
117 0.09
118 0.09
119 0.1
120 0.09
121 0.1
122 0.11
123 0.11
124 0.1
125 0.1
126 0.09
127 0.09
128 0.08
129 0.08
130 0.05
131 0.05
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.07
138 0.06
139 0.08
140 0.09
141 0.11
142 0.13
143 0.13
144 0.16
145 0.15
146 0.16
147 0.15
148 0.22
149 0.29
150 0.32
151 0.41
152 0.45
153 0.5
154 0.58
155 0.68
156 0.71
157 0.72
158 0.76
159 0.75
160 0.78
161 0.84
162 0.86
163 0.86
164 0.86
165 0.85
166 0.86
167 0.81
168 0.72
169 0.64
170 0.58
171 0.52
172 0.45
173 0.37
174 0.31
175 0.3
176 0.31
177 0.29
178 0.24
179 0.2
180 0.18
181 0.15
182 0.15
183 0.12
184 0.11
185 0.11
186 0.12
187 0.16
188 0.21
189 0.21
190 0.18
191 0.18
192 0.17
193 0.2
194 0.25
195 0.23
196 0.18
197 0.19
198 0.21
199 0.21
200 0.22
201 0.21
202 0.18
203 0.18
204 0.18
205 0.25
206 0.24
207 0.24
208 0.25
209 0.24
210 0.24