Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VBI9

Protein Details
Accession G0VBI9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-36NKNIEKHRKYGKKKIAKNQESBasic
NLS Segment(s)
PositionSequence
19-31IEKHRKYGKKKIA
Subcellular Location(s) nucl 11, mito 5, plas 3, E.R. 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
KEGG ncs:NCAS_0B02310  -  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAIQTPKQRIANEKFNKNIEKHRKYGKKKIAKNQESSLPISRLWIGVILFLLIGGGVLELLSYIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.63
3 0.66
4 0.61
5 0.64
6 0.64
7 0.61
8 0.6
9 0.65
10 0.69
11 0.71
12 0.78
13 0.78
14 0.76
15 0.79
16 0.83
17 0.84
18 0.8
19 0.76
20 0.68
21 0.64
22 0.57
23 0.52
24 0.46
25 0.36
26 0.29
27 0.26
28 0.23
29 0.17
30 0.14
31 0.13
32 0.09
33 0.08
34 0.08
35 0.07
36 0.06
37 0.05
38 0.05
39 0.03
40 0.03
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02