Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9TV03

Protein Details
Accession A0A1L9TV03    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
64-86LRAVPKKKTSHMKKRHRQMAGKABasic
NLS Segment(s)
PositionSequence
68-83PKKKTSHMKKRHRQMA
Subcellular Location(s) mito 23, nucl 1, cyto 1, plas 1, cyto_nucl 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MALRPLSRNPLLQIFPRLVVPSKSLRFTISLPSQHHVFLSAFHRPVAFALNVPGLLSDLWESVLRAVPKKKTSHMKKRHRQMAGKALKDVRNLNTCPACGQIKRSHVLCQHCVENIKKQWGKAQLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.31
4 0.3
5 0.26
6 0.25
7 0.24
8 0.28
9 0.3
10 0.31
11 0.3
12 0.29
13 0.29
14 0.28
15 0.33
16 0.31
17 0.34
18 0.34
19 0.36
20 0.35
21 0.33
22 0.32
23 0.26
24 0.19
25 0.17
26 0.18
27 0.2
28 0.19
29 0.19
30 0.19
31 0.17
32 0.17
33 0.17
34 0.13
35 0.09
36 0.1
37 0.1
38 0.09
39 0.09
40 0.09
41 0.06
42 0.05
43 0.05
44 0.04
45 0.04
46 0.05
47 0.05
48 0.05
49 0.05
50 0.08
51 0.09
52 0.11
53 0.15
54 0.19
55 0.24
56 0.27
57 0.32
58 0.41
59 0.51
60 0.59
61 0.66
62 0.73
63 0.77
64 0.85
65 0.88
66 0.85
67 0.81
68 0.77
69 0.77
70 0.75
71 0.67
72 0.61
73 0.58
74 0.53
75 0.5
76 0.46
77 0.41
78 0.38
79 0.37
80 0.39
81 0.36
82 0.33
83 0.3
84 0.31
85 0.3
86 0.25
87 0.3
88 0.31
89 0.34
90 0.38
91 0.39
92 0.42
93 0.44
94 0.5
95 0.49
96 0.46
97 0.44
98 0.42
99 0.46
100 0.43
101 0.46
102 0.46
103 0.52
104 0.5
105 0.5
106 0.53