Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9T1C1

Protein Details
Accession A0A1L9T1C1   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
148-177AGTLDKEERKKLKKERRKAEKKAKLKETEEBasic
NLS Segment(s)
PositionSequence
155-173ERKKLKKERRKAEKKAKLK
Subcellular Location(s) cyto_nucl 13.833, nucl 13.5, cyto 12, mito_nucl 8.166
Family & Domain DBs
Amino Acid Sequences MSAQDPTPLPPTTVLSSKPISQSIAHDFLAAYLDRATTDPALQPNAGISEHGPVSRTTAAAPNIILHNLKRVQAGLTGEVLGRDLAIAEMKEGAQAQAQTQDGNDEGSWEDKKQFEREQEIEGNGVNVGGEEAMDVDDTEAAVEGNAAGTLDKEERKKLKKERRKAEKKAKLKETEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.29
4 0.31
5 0.32
6 0.3
7 0.28
8 0.26
9 0.29
10 0.31
11 0.33
12 0.29
13 0.26
14 0.24
15 0.22
16 0.23
17 0.18
18 0.12
19 0.08
20 0.08
21 0.08
22 0.09
23 0.11
24 0.09
25 0.11
26 0.12
27 0.14
28 0.16
29 0.16
30 0.15
31 0.14
32 0.14
33 0.13
34 0.11
35 0.09
36 0.1
37 0.1
38 0.11
39 0.11
40 0.09
41 0.13
42 0.13
43 0.13
44 0.11
45 0.15
46 0.16
47 0.16
48 0.16
49 0.14
50 0.14
51 0.15
52 0.14
53 0.1
54 0.14
55 0.15
56 0.16
57 0.15
58 0.15
59 0.15
60 0.16
61 0.17
62 0.13
63 0.12
64 0.11
65 0.1
66 0.1
67 0.09
68 0.06
69 0.05
70 0.04
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.05
83 0.06
84 0.08
85 0.09
86 0.08
87 0.08
88 0.09
89 0.08
90 0.09
91 0.08
92 0.06
93 0.06
94 0.09
95 0.1
96 0.1
97 0.12
98 0.13
99 0.16
100 0.2
101 0.24
102 0.26
103 0.32
104 0.33
105 0.36
106 0.36
107 0.34
108 0.29
109 0.25
110 0.21
111 0.14
112 0.12
113 0.07
114 0.05
115 0.04
116 0.03
117 0.03
118 0.02
119 0.03
120 0.03
121 0.03
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.04
137 0.06
138 0.1
139 0.15
140 0.17
141 0.26
142 0.35
143 0.43
144 0.52
145 0.61
146 0.69
147 0.76
148 0.84
149 0.87
150 0.89
151 0.93
152 0.94
153 0.95
154 0.94
155 0.94
156 0.94
157 0.92