Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9T1F9

Protein Details
Accession A0A1L9T1F9    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
34-64LPDPSELPRWPPQRRKKLPRKTPIRTFLKSQHydrophilic
NLS Segment(s)
PositionSequence
44-55PPQRRKKLPRKT
Subcellular Location(s) nucl 20.5, cyto_nucl 12, cyto 2.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038887  Nus1/NgBR  
IPR036424  UPP_synth-like_sf  
Gene Ontology GO:1904423  C:dehydrodolichyl diphosphate synthase complex  
GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0016765  F:transferase activity, transferring alkyl or aryl (other than methyl) groups  
GO:0019408  P:dolichol biosynthetic process  
GO:0006486  P:protein glycosylation  
Amino Acid Sequences MVSKRDRELLRNNIRSREGKLSATDRESILKPYLPDPSELPRWPPQRRKKLPRKTPIRTFLKSQIHLITYTFLHIFFGIAVRLVQSFHAVVDRILAIIYYHHRTPELIRKDVKGLDRLPEHLSVVLSLRKEDDALPILMDEVAELVSWSASAGIPVLSVYERSGVLKSCIPILHQAITKKLSSYFGTSQQPGLQLFAPHHPVYESRQDGDASHTFLVVLLLSATDGQETFVDLTKTLAEMSQNGKLSPEDITTELVDAEISEITTQPSQEITSTSTQNNLDCPRIPQPVKPEPDLLLVFGQSLKLNGYPPWHIRLTEMYCTGVNSDGVSGYNETVEYQGFLRGLWHYAGAQMRFGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.68
3 0.64
4 0.62
5 0.55
6 0.48
7 0.5
8 0.49
9 0.48
10 0.48
11 0.45
12 0.37
13 0.38
14 0.36
15 0.34
16 0.31
17 0.28
18 0.27
19 0.27
20 0.34
21 0.3
22 0.31
23 0.3
24 0.34
25 0.38
26 0.38
27 0.41
28 0.42
29 0.5
30 0.58
31 0.66
32 0.7
33 0.74
34 0.83
35 0.89
36 0.91
37 0.93
38 0.94
39 0.94
40 0.94
41 0.93
42 0.92
43 0.91
44 0.89
45 0.82
46 0.77
47 0.76
48 0.75
49 0.66
50 0.6
51 0.54
52 0.46
53 0.43
54 0.38
55 0.3
56 0.21
57 0.21
58 0.17
59 0.13
60 0.12
61 0.11
62 0.1
63 0.08
64 0.09
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.08
73 0.08
74 0.08
75 0.1
76 0.09
77 0.09
78 0.1
79 0.1
80 0.08
81 0.08
82 0.07
83 0.06
84 0.08
85 0.12
86 0.13
87 0.14
88 0.15
89 0.15
90 0.16
91 0.21
92 0.29
93 0.32
94 0.34
95 0.36
96 0.37
97 0.4
98 0.44
99 0.41
100 0.37
101 0.32
102 0.33
103 0.32
104 0.33
105 0.32
106 0.28
107 0.26
108 0.21
109 0.19
110 0.14
111 0.14
112 0.14
113 0.12
114 0.11
115 0.12
116 0.11
117 0.12
118 0.11
119 0.12
120 0.12
121 0.12
122 0.12
123 0.1
124 0.1
125 0.09
126 0.09
127 0.06
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.06
149 0.07
150 0.08
151 0.08
152 0.09
153 0.11
154 0.11
155 0.11
156 0.11
157 0.11
158 0.14
159 0.15
160 0.16
161 0.17
162 0.17
163 0.18
164 0.2
165 0.2
166 0.17
167 0.17
168 0.16
169 0.15
170 0.19
171 0.18
172 0.22
173 0.25
174 0.24
175 0.24
176 0.23
177 0.23
178 0.19
179 0.18
180 0.13
181 0.11
182 0.12
183 0.13
184 0.17
185 0.15
186 0.15
187 0.14
188 0.14
189 0.18
190 0.24
191 0.23
192 0.19
193 0.21
194 0.21
195 0.21
196 0.25
197 0.22
198 0.17
199 0.16
200 0.15
201 0.13
202 0.13
203 0.12
204 0.07
205 0.06
206 0.03
207 0.03
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.04
214 0.04
215 0.05
216 0.06
217 0.07
218 0.08
219 0.08
220 0.08
221 0.08
222 0.08
223 0.08
224 0.08
225 0.06
226 0.09
227 0.12
228 0.16
229 0.17
230 0.17
231 0.17
232 0.17
233 0.17
234 0.16
235 0.14
236 0.11
237 0.11
238 0.13
239 0.12
240 0.12
241 0.11
242 0.1
243 0.08
244 0.06
245 0.06
246 0.05
247 0.05
248 0.04
249 0.05
250 0.07
251 0.08
252 0.08
253 0.07
254 0.08
255 0.09
256 0.09
257 0.1
258 0.12
259 0.15
260 0.18
261 0.18
262 0.21
263 0.22
264 0.22
265 0.26
266 0.26
267 0.25
268 0.24
269 0.28
270 0.3
271 0.38
272 0.39
273 0.37
274 0.43
275 0.49
276 0.53
277 0.51
278 0.48
279 0.41
280 0.44
281 0.4
282 0.33
283 0.25
284 0.2
285 0.18
286 0.15
287 0.15
288 0.1
289 0.1
290 0.1
291 0.1
292 0.12
293 0.13
294 0.17
295 0.22
296 0.25
297 0.3
298 0.3
299 0.29
300 0.3
301 0.36
302 0.38
303 0.37
304 0.35
305 0.32
306 0.3
307 0.3
308 0.29
309 0.22
310 0.17
311 0.13
312 0.12
313 0.1
314 0.11
315 0.12
316 0.12
317 0.11
318 0.11
319 0.11
320 0.11
321 0.11
322 0.11
323 0.1
324 0.09
325 0.12
326 0.11
327 0.11
328 0.13
329 0.13
330 0.15
331 0.15
332 0.15
333 0.13
334 0.18
335 0.24
336 0.23