Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0VFD0

Protein Details
Accession G0VFD0    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
180-200EFEKKVYKKSHESYKETKKWMHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12cyto_nucl 12, nucl 10, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR021151  GINS_A  
IPR036224  GINS_bundle-like_dom_sf  
IPR010492  GINS_Psf3  
IPR038437  GINS_Psf3_sf  
Gene Ontology GO:0000811  C:GINS complex  
GO:0006260  P:DNA replication  
KEGG ncs:NCAS_0E01260  -  
Pfam View protein in Pfam  
PF05916  Sld5  
CDD cd11713  GINS_A_psf3  
cd21693  GINS_B_Psf3  
Amino Acid Sequences MGYYDIDDILADSVEIPCKFQHDIPGLGYLENNPGKPVKKNAKLELPLWLARILAIIDGDTNEGELNQDEESVPFVELLTPDMFSPKVINAIKADPTSLDLHAINSYFYALALKWISLFSDREFADIVTTLLLERSQAINNHASSVSVEFKSSLDSVRGTQVTAGASNAAASMFLLTLDEFEKKVYKKSHESYKETKKWMFEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.13
4 0.13
5 0.16
6 0.19
7 0.2
8 0.27
9 0.26
10 0.28
11 0.28
12 0.33
13 0.3
14 0.28
15 0.27
16 0.2
17 0.23
18 0.23
19 0.22
20 0.18
21 0.22
22 0.24
23 0.28
24 0.37
25 0.4
26 0.47
27 0.55
28 0.59
29 0.65
30 0.66
31 0.62
32 0.6
33 0.54
34 0.46
35 0.4
36 0.33
37 0.24
38 0.2
39 0.2
40 0.12
41 0.08
42 0.06
43 0.05
44 0.05
45 0.05
46 0.06
47 0.05
48 0.05
49 0.05
50 0.04
51 0.05
52 0.05
53 0.06
54 0.05
55 0.06
56 0.06
57 0.06
58 0.08
59 0.08
60 0.08
61 0.06
62 0.06
63 0.07
64 0.07
65 0.09
66 0.07
67 0.07
68 0.07
69 0.08
70 0.08
71 0.08
72 0.08
73 0.06
74 0.13
75 0.13
76 0.14
77 0.15
78 0.16
79 0.18
80 0.18
81 0.17
82 0.11
83 0.13
84 0.13
85 0.11
86 0.11
87 0.09
88 0.1
89 0.1
90 0.1
91 0.08
92 0.06
93 0.06
94 0.05
95 0.05
96 0.05
97 0.04
98 0.06
99 0.06
100 0.06
101 0.06
102 0.06
103 0.07
104 0.08
105 0.1
106 0.08
107 0.13
108 0.13
109 0.14
110 0.14
111 0.13
112 0.12
113 0.11
114 0.11
115 0.06
116 0.06
117 0.05
118 0.05
119 0.05
120 0.04
121 0.05
122 0.07
123 0.09
124 0.1
125 0.13
126 0.17
127 0.17
128 0.19
129 0.18
130 0.16
131 0.15
132 0.16
133 0.17
134 0.13
135 0.14
136 0.12
137 0.13
138 0.15
139 0.14
140 0.13
141 0.11
142 0.12
143 0.13
144 0.18
145 0.18
146 0.16
147 0.16
148 0.16
149 0.15
150 0.15
151 0.14
152 0.09
153 0.08
154 0.08
155 0.08
156 0.06
157 0.05
158 0.04
159 0.05
160 0.04
161 0.04
162 0.05
163 0.04
164 0.06
165 0.07
166 0.09
167 0.08
168 0.1
169 0.17
170 0.18
171 0.25
172 0.32
173 0.38
174 0.46
175 0.54
176 0.63
177 0.66
178 0.73
179 0.76
180 0.8
181 0.81
182 0.79
183 0.75