Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9TI82

Protein Details
Accession A0A1L9TI82    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
44-65PQSSTRKPSNSRRNRQTRDCTIHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, golg 5, plas 4, mito 3, E.R. 3
Family & Domain DBs
Amino Acid Sequences MIRVLAPCIQLSLSLILELNDSLAALYWAPRRDLKLQQKISGFPQSSTRKPSNSRRNRQTRDCTIPPLPRMLKPWGDLGECRGCGAENLISNTMSDLISDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.1
5 0.09
6 0.08
7 0.06
8 0.05
9 0.05
10 0.04
11 0.05
12 0.04
13 0.07
14 0.11
15 0.12
16 0.14
17 0.16
18 0.2
19 0.25
20 0.35
21 0.42
22 0.49
23 0.51
24 0.54
25 0.54
26 0.52
27 0.51
28 0.48
29 0.38
30 0.29
31 0.34
32 0.35
33 0.35
34 0.4
35 0.38
36 0.35
37 0.41
38 0.51
39 0.53
40 0.59
41 0.66
42 0.7
43 0.79
44 0.82
45 0.84
46 0.82
47 0.79
48 0.77
49 0.7
50 0.65
51 0.61
52 0.59
53 0.51
54 0.5
55 0.44
56 0.38
57 0.4
58 0.39
59 0.36
60 0.32
61 0.36
62 0.31
63 0.31
64 0.29
65 0.3
66 0.31
67 0.28
68 0.27
69 0.22
70 0.19
71 0.18
72 0.2
73 0.18
74 0.15
75 0.19
76 0.2
77 0.2
78 0.2
79 0.2
80 0.19
81 0.15