Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0V7S9

Protein Details
Accession G0V7S9    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
13-34TVNLHRKAQKAGKKRAARERAGHydrophilic
NLS Segment(s)
PositionSequence
17-32HRKAQKAGKKRAARER
85-90KKRAKK
Subcellular Location(s) nucl 16.5, cyto_nucl 11, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
KEGG ncs:NCAS_0A09690  -  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MPSKNSINRPKQTVNLHRKAQKAGKKRAARERAGQFNPARSSDSSRSGEIKSVSLDLYRAGKVENGAGNGTASTNGAVTSRTLSKKRAKKIERNLKYAEQRRLLTDLTAKLEDSNEGMEIDAVGGGRAKKVEKKTALGQVKEALWNVIEDSSSQGLVIGSGQGTTLGGPMFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.74
3 0.76
4 0.74
5 0.73
6 0.74
7 0.72
8 0.71
9 0.7
10 0.72
11 0.74
12 0.76
13 0.81
14 0.83
15 0.83
16 0.79
17 0.78
18 0.75
19 0.75
20 0.69
21 0.68
22 0.59
23 0.57
24 0.55
25 0.47
26 0.41
27 0.33
28 0.38
29 0.34
30 0.39
31 0.35
32 0.34
33 0.35
34 0.33
35 0.34
36 0.28
37 0.25
38 0.19
39 0.18
40 0.16
41 0.13
42 0.13
43 0.11
44 0.12
45 0.11
46 0.1
47 0.1
48 0.1
49 0.1
50 0.13
51 0.13
52 0.11
53 0.11
54 0.11
55 0.11
56 0.1
57 0.09
58 0.07
59 0.05
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.05
66 0.07
67 0.11
68 0.14
69 0.16
70 0.22
71 0.31
72 0.37
73 0.45
74 0.53
75 0.57
76 0.63
77 0.73
78 0.78
79 0.76
80 0.74
81 0.71
82 0.67
83 0.69
84 0.66
85 0.62
86 0.55
87 0.49
88 0.46
89 0.44
90 0.38
91 0.3
92 0.26
93 0.22
94 0.2
95 0.19
96 0.17
97 0.15
98 0.15
99 0.14
100 0.11
101 0.1
102 0.07
103 0.07
104 0.07
105 0.06
106 0.06
107 0.05
108 0.05
109 0.04
110 0.04
111 0.05
112 0.06
113 0.06
114 0.08
115 0.11
116 0.17
117 0.23
118 0.32
119 0.34
120 0.39
121 0.44
122 0.53
123 0.58
124 0.53
125 0.49
126 0.44
127 0.42
128 0.39
129 0.33
130 0.24
131 0.17
132 0.16
133 0.14
134 0.11
135 0.1
136 0.08
137 0.12
138 0.12
139 0.11
140 0.11
141 0.1
142 0.1
143 0.1
144 0.1
145 0.07
146 0.06
147 0.06
148 0.06
149 0.06
150 0.06
151 0.06
152 0.07