Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SXS9

Protein Details
Accession A0A1L9SXS9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-63DVLITRTTKKPKCKSISKPKRGPSRHydrophilic
NLS Segment(s)
PositionSequence
47-63KKPKCKSISKPKRGPSR
Subcellular Location(s) nucl 21, mito_nucl 12.833, cyto_nucl 12.333, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018228  DNase_TatD-rel_CS  
PROSITE View protein in PROSITE  
PS01137  TATD_1  
Amino Acid Sequences MIQITKYHFNEKQCCQSSWKASHADYLQVHIMDSHLHLDVLITRTTKKPKCKSISKPKRGPSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.53
3 0.56
4 0.57
5 0.53
6 0.52
7 0.45
8 0.41
9 0.44
10 0.39
11 0.38
12 0.3
13 0.27
14 0.24
15 0.2
16 0.19
17 0.14
18 0.13
19 0.08
20 0.08
21 0.07
22 0.06
23 0.05
24 0.05
25 0.06
26 0.08
27 0.09
28 0.11
29 0.1
30 0.12
31 0.18
32 0.27
33 0.34
34 0.42
35 0.49
36 0.58
37 0.67
38 0.75
39 0.81
40 0.84
41 0.89
42 0.89
43 0.9