FuNGI

A0A1L9TH11

Protein Details

Accession

A0A1L9TH11

Localization Confidence

Low

Confidence Score

7.2

NoLS Segment(s)

Position	Sequence	Protein Nature
1-23	MPPKQSKSHTPKRRVTPVVPPAP	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 18, nucl 6.5, cyto_nucl 5

Family & Domain DBs

InterPro	View protein in InterPro IPR019382 eIF3l IPR000717 PCI_dom
Gene Ontology	GO:0016282 C:eukaryotic 43S preinitiation complex GO:0033290 C:eukaryotic 48S preinitiation complex GO:0005852 C:eukaryotic translation initiation factor 3 complex GO:0016020 C:membrane GO:0003743 F:translation initiation factor activity GO:0001732 P:formation of cytoplasmic translation initiation complex
Pfam	View protein in Pfam PF10255 Paf67
PROSITE	View protein in PROSITE PS50250 PCI

Amino Acid Sequences

MPPKQSKSHTPKRRVTPVVPPAPAPSSCRQFSRTDSERDLLPNMSYEERANAHPNLNDESDVEEEALVNDYREQVNFDDGMSELDRTTSLGGASQTQDLQAQLAAAATPLEYQATLETKFASYDNYCSLFHYILNSDGPVELEVPSYYWAWDVIDEFIYQFESFCRYRNRVARSGSNEEEAQLLRENPNTWGCYSVLNVLYSLIQKSQINEQLAAMKRGEDPAAYAGEYGSRPLYKMLGYFSIIGLLRVHCLLGDFSLALKTLDDIEMNKKAMFARVMAAHFTTYYYVGFSYMMTRRYGDAIRMFSHILVYVSRTKNFQKGGNSYDAIAKKNDQMYALIAICVALHPTRLDDTIHSALREKYGEQLHRLQQGGPDALPLFEELFRSACPKFISPTPPDFDNPALNVDPVDHHTAIFMDEVKNTLYNPTIRSYLKLYTTMDLQKLAGFLEVEPEKLRSWLLINKQRSRQVRWVEGGLLDGEIVSANDLDYALEKDLIHVSETKAGRRLVDWYLRNLARVY

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.86
2	0.81
3	0.81
4	0.81
5	0.8
6	0.72
7	0.63
8	0.57
9	0.53
10	0.5
11	0.44
12	0.42
13	0.4
14	0.42
15	0.44
16	0.44
17	0.43
18	0.47
19	0.52
20	0.5
21	0.5
22	0.52
23	0.5
24	0.49
25	0.48
26	0.45
27	0.36
28	0.3
29	0.25
30	0.23
31	0.23
32	0.22
33	0.2
34	0.21
35	0.21
36	0.24
37	0.27
38	0.27
39	0.29
40	0.29
41	0.32
42	0.32
43	0.31
44	0.28
45	0.24
46	0.24
47	0.21
48	0.2
49	0.17
50	0.13
51	0.11
52	0.11
53	0.13
54	0.1
55	0.09
56	0.09
57	0.11
58	0.13
59	0.13
60	0.15
61	0.13
62	0.16
63	0.16
64	0.15
65	0.14
66	0.13
67	0.15
68	0.14
69	0.13
70	0.1
71	0.1
72	0.1
73	0.1
74	0.1
75	0.08
76	0.07
77	0.09
78	0.1
79	0.12
80	0.13
81	0.14
82	0.14
83	0.13
84	0.14
85	0.12
86	0.12
87	0.1
88	0.08
89	0.07
90	0.07
91	0.06
92	0.05
93	0.05
94	0.04
95	0.04
96	0.05
97	0.05
98	0.05
99	0.05
100	0.07
101	0.1
102	0.11
103	0.11
104	0.12
105	0.12
106	0.13
107	0.13
108	0.14
109	0.13
110	0.15
111	0.18
112	0.2
113	0.2
114	0.21
115	0.23
116	0.19
117	0.18
118	0.18
119	0.16
120	0.15
121	0.15
122	0.14
123	0.12
124	0.11
125	0.11
126	0.09
127	0.09
128	0.07
129	0.07
130	0.07
131	0.07
132	0.09
133	0.09
134	0.08
135	0.08
136	0.08
137	0.07
138	0.08
139	0.08
140	0.08
141	0.08
142	0.08
143	0.08
144	0.08
145	0.09
146	0.08
147	0.08
148	0.07
149	0.11
150	0.11
151	0.16
152	0.22
153	0.24
154	0.32
155	0.4
156	0.46
157	0.48
158	0.52
159	0.55
160	0.56
161	0.59
162	0.53
163	0.49
164	0.42
165	0.35
166	0.32
167	0.25
168	0.19
169	0.13
170	0.13
171	0.11
172	0.13
173	0.13
174	0.14
175	0.17
176	0.17
177	0.16
178	0.17
179	0.16
180	0.16
181	0.16
182	0.17
183	0.15
184	0.14
185	0.14
186	0.12
187	0.13
188	0.12
189	0.12
190	0.09
191	0.1
192	0.1
193	0.12
194	0.17
195	0.21
196	0.21
197	0.21
198	0.21
199	0.25
200	0.26
201	0.26
202	0.21
203	0.17
204	0.16
205	0.17
206	0.16
207	0.09
208	0.09
209	0.09
210	0.1
211	0.08
212	0.08
213	0.07
214	0.08
215	0.08
216	0.08
217	0.08
218	0.07
219	0.07
220	0.08
221	0.09
222	0.08
223	0.09
224	0.09
225	0.1
226	0.11
227	0.11
228	0.1
229	0.12
230	0.11
231	0.11
232	0.1
233	0.09
234	0.08
235	0.08
236	0.08
237	0.05
238	0.05
239	0.05
240	0.04
241	0.05
242	0.04
243	0.04
244	0.05
245	0.05
246	0.05
247	0.04
248	0.04
249	0.05
250	0.05
251	0.05
252	0.06
253	0.09
254	0.12
255	0.13
256	0.12
257	0.13
258	0.13
259	0.14
260	0.14
261	0.11
262	0.1
263	0.12
264	0.13
265	0.12
266	0.12
267	0.11
268	0.1
269	0.1
270	0.09
271	0.07
272	0.06
273	0.06
274	0.06
275	0.06
276	0.06
277	0.06
278	0.1
279	0.12
280	0.13
281	0.14
282	0.14
283	0.14
284	0.17
285	0.17
286	0.16
287	0.17
288	0.18
289	0.19
290	0.2
291	0.2
292	0.17
293	0.17
294	0.14
295	0.11
296	0.09
297	0.1
298	0.16
299	0.18
300	0.19
301	0.21
302	0.23
303	0.28
304	0.3
305	0.32
306	0.31
307	0.33
308	0.36
309	0.38
310	0.36
311	0.31
312	0.35
313	0.32
314	0.28
315	0.25
316	0.22
317	0.22
318	0.24
319	0.24
320	0.18
321	0.17
322	0.17
323	0.19
324	0.17
325	0.13
326	0.11
327	0.09
328	0.09
329	0.08
330	0.08
331	0.05
332	0.05
333	0.05
334	0.07
335	0.08
336	0.09
337	0.1
338	0.1
339	0.16
340	0.19
341	0.2
342	0.2
343	0.21
344	0.21
345	0.22
346	0.22
347	0.17
348	0.18
349	0.24
350	0.26
351	0.28
352	0.34
353	0.37
354	0.4
355	0.41
356	0.36
357	0.32
358	0.32
359	0.3
360	0.23
361	0.2
362	0.15
363	0.14
364	0.14
365	0.12
366	0.09
367	0.09
368	0.09
369	0.09
370	0.09
371	0.1
372	0.13
373	0.12
374	0.14
375	0.16
376	0.17
377	0.19
378	0.24
379	0.3
380	0.32
381	0.38
382	0.38
383	0.38
384	0.38
385	0.38
386	0.35
387	0.31
388	0.27
389	0.25
390	0.22
391	0.19
392	0.18
393	0.16
394	0.15
395	0.15
396	0.19
397	0.16
398	0.15
399	0.15
400	0.16
401	0.16
402	0.15
403	0.13
404	0.09
405	0.1
406	0.11
407	0.12
408	0.12
409	0.11
410	0.12
411	0.14
412	0.16
413	0.18
414	0.2
415	0.24
416	0.24
417	0.26
418	0.28
419	0.29
420	0.29
421	0.31
422	0.3
423	0.27
424	0.32
425	0.34
426	0.31
427	0.28
428	0.25
429	0.22
430	0.21
431	0.19
432	0.15
433	0.11
434	0.09
435	0.15
436	0.15
437	0.16
438	0.17
439	0.18
440	0.18
441	0.18
442	0.18
443	0.12
444	0.16
445	0.22
446	0.31
447	0.39
448	0.47
449	0.55
450	0.62
451	0.69
452	0.72
453	0.73
454	0.72
455	0.72
456	0.71
457	0.67
458	0.62
459	0.55
460	0.49
461	0.42
462	0.33
463	0.24
464	0.16
465	0.11
466	0.08
467	0.06
468	0.06
469	0.05
470	0.05
471	0.05
472	0.05
473	0.05
474	0.06
475	0.07
476	0.09
477	0.1
478	0.12
479	0.12
480	0.13
481	0.17
482	0.17
483	0.17
484	0.18
485	0.18
486	0.24
487	0.27
488	0.29
489	0.31
490	0.32
491	0.32
492	0.31
493	0.34
494	0.34
495	0.41
496	0.4
497	0.4
498	0.48
499	0.48

A0A1L9TH11

3D AlphaFold-predicted Structure Viewer