Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9TK06

Protein Details
Accession A0A1L9TK06   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
186-217IRGMSRAERKEKIRRNERKMRSNERNAKKSGGBasic
NLS Segment(s)
PositionSequence
102-138PTPKPPTKWELFARKKGIGKYNNKPGAALADKERRKK
190-218SRAERKEKIRRNERKMRSNERNAKKSGGR
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MTNSAIEAKSASKSKPERLPITVSKPTPYTFDLGHLLANDPNPLELPRSEPLNGSLKATARDGVQSLLNQLLTTCQITSSQQGVLLSLPQPSTTLPRHKPLPTPKPPTKWELFARKKGIGKYNNKPGAALADKERRKKLVYDEESGEWVPRWGYKGKNKADDEWLVEVKEKDWKKEEDAAAQGSSIRGMSRAERKEKIRRNERKMRSNERNAKKSGGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.5
3 0.57
4 0.57
5 0.57
6 0.64
7 0.62
8 0.65
9 0.65
10 0.57
11 0.52
12 0.49
13 0.46
14 0.41
15 0.36
16 0.3
17 0.23
18 0.24
19 0.24
20 0.22
21 0.22
22 0.18
23 0.18
24 0.17
25 0.17
26 0.14
27 0.11
28 0.11
29 0.11
30 0.11
31 0.12
32 0.11
33 0.15
34 0.16
35 0.19
36 0.19
37 0.19
38 0.22
39 0.27
40 0.27
41 0.24
42 0.24
43 0.23
44 0.24
45 0.24
46 0.21
47 0.15
48 0.16
49 0.15
50 0.13
51 0.13
52 0.12
53 0.12
54 0.12
55 0.11
56 0.1
57 0.09
58 0.09
59 0.09
60 0.09
61 0.08
62 0.07
63 0.08
64 0.09
65 0.12
66 0.12
67 0.11
68 0.12
69 0.11
70 0.11
71 0.11
72 0.11
73 0.09
74 0.09
75 0.09
76 0.07
77 0.08
78 0.08
79 0.13
80 0.16
81 0.23
82 0.25
83 0.29
84 0.34
85 0.36
86 0.43
87 0.48
88 0.54
89 0.55
90 0.62
91 0.64
92 0.65
93 0.66
94 0.64
95 0.56
96 0.51
97 0.48
98 0.5
99 0.5
100 0.51
101 0.52
102 0.51
103 0.52
104 0.5
105 0.52
106 0.5
107 0.52
108 0.53
109 0.59
110 0.6
111 0.56
112 0.53
113 0.44
114 0.41
115 0.35
116 0.28
117 0.24
118 0.28
119 0.33
120 0.38
121 0.4
122 0.37
123 0.37
124 0.39
125 0.42
126 0.44
127 0.44
128 0.43
129 0.43
130 0.42
131 0.42
132 0.39
133 0.31
134 0.2
135 0.16
136 0.12
137 0.1
138 0.12
139 0.14
140 0.21
141 0.29
142 0.39
143 0.45
144 0.54
145 0.55
146 0.56
147 0.57
148 0.53
149 0.48
150 0.43
151 0.38
152 0.29
153 0.29
154 0.26
155 0.21
156 0.26
157 0.24
158 0.25
159 0.29
160 0.31
161 0.34
162 0.42
163 0.43
164 0.4
165 0.42
166 0.4
167 0.35
168 0.32
169 0.28
170 0.19
171 0.17
172 0.12
173 0.09
174 0.07
175 0.09
176 0.15
177 0.24
178 0.32
179 0.39
180 0.45
181 0.53
182 0.63
183 0.71
184 0.76
185 0.77
186 0.81
187 0.84
188 0.88
189 0.9
190 0.89
191 0.9
192 0.9
193 0.89
194 0.9
195 0.9
196 0.9
197 0.88
198 0.81