Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SY73

Protein Details
Accession A0A1L9SY73   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-34PVPSQNRVKQEQIRKRRNNLLPRHNDFWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 13.5, nucl 12.5
Family & Domain DBs
Amino Acid Sequences MNLRYVPXVPSQNRVKQEQIRKRRNNLLPRHNDFWRLYTIRSWTTLEMPNGRIYTYLSHPQIPAPTDREINLMLPDSAGTAPASRAQNTGGLWSSRPDRHGVAGATLSKGAWTAKSTLGFTLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.6
3 0.65
4 0.71
5 0.72
6 0.78
7 0.8
8 0.83
9 0.85
10 0.85
11 0.84
12 0.84
13 0.84
14 0.82
15 0.81
16 0.78
17 0.7
18 0.67
19 0.58
20 0.5
21 0.46
22 0.38
23 0.32
24 0.3
25 0.32
26 0.27
27 0.28
28 0.27
29 0.21
30 0.23
31 0.26
32 0.25
33 0.24
34 0.24
35 0.24
36 0.23
37 0.22
38 0.18
39 0.15
40 0.15
41 0.15
42 0.2
43 0.18
44 0.19
45 0.19
46 0.2
47 0.21
48 0.19
49 0.18
50 0.15
51 0.16
52 0.15
53 0.16
54 0.16
55 0.15
56 0.15
57 0.13
58 0.11
59 0.09
60 0.08
61 0.08
62 0.07
63 0.06
64 0.06
65 0.06
66 0.05
67 0.06
68 0.11
69 0.13
70 0.13
71 0.14
72 0.14
73 0.16
74 0.16
75 0.18
76 0.15
77 0.15
78 0.15
79 0.17
80 0.22
81 0.21
82 0.23
83 0.23
84 0.23
85 0.24
86 0.28
87 0.26
88 0.23
89 0.24
90 0.24
91 0.22
92 0.2
93 0.17
94 0.13
95 0.14
96 0.12
97 0.11
98 0.12
99 0.14
100 0.18
101 0.21
102 0.22