Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9TZK3

Protein Details
Accession A0A1L9TZK3   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-85VQKKPSQTSSAKRYRRRREKKKEEKENMKKEEEKBasic
NLS Segment(s)
PositionSequence
60-92SSAKRYRRRREKKKEEKENMKKEEEKGEEKREE
Subcellular Location(s) nucl 21, cyto_nucl 12.333, mito_nucl 12.333, mito 2.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MPKKDNTLNLMAALANIQAASAQAMNTLIQDHTLTQTRRPPAAATAAAPSGVQKKPSQTSSAKRYRRRREKKKEEKENMKKEEEKGEEKREEEGEGKGEKTGSKDGEMTYTNIEIDYELTGDDANTLAEELLTNLNDDLHEPGETPIVEDTLSHDETLFILQSTAAEAQTVPSAPLLDEDFNELEDMPPPPRPGLQSSLSNDLEPVSYPCYSYALAPFHLLLALWCMNANISRQQYVSLREILCTLQNSLPLPYETLRQACKGQFPILPVRKYKIPVIPSKMPTLSAAEKQLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.08
3 0.07
4 0.06
5 0.05
6 0.05
7 0.06
8 0.06
9 0.06
10 0.06
11 0.07
12 0.08
13 0.08
14 0.09
15 0.08
16 0.09
17 0.1
18 0.1
19 0.13
20 0.21
21 0.22
22 0.25
23 0.33
24 0.37
25 0.38
26 0.38
27 0.36
28 0.32
29 0.37
30 0.33
31 0.27
32 0.25
33 0.24
34 0.22
35 0.2
36 0.19
37 0.19
38 0.19
39 0.2
40 0.2
41 0.26
42 0.32
43 0.35
44 0.39
45 0.41
46 0.48
47 0.55
48 0.63
49 0.67
50 0.71
51 0.79
52 0.83
53 0.87
54 0.9
55 0.91
56 0.92
57 0.95
58 0.96
59 0.97
60 0.97
61 0.96
62 0.96
63 0.95
64 0.94
65 0.89
66 0.84
67 0.77
68 0.69
69 0.67
70 0.61
71 0.58
72 0.54
73 0.55
74 0.51
75 0.48
76 0.47
77 0.4
78 0.36
79 0.3
80 0.25
81 0.21
82 0.19
83 0.18
84 0.16
85 0.16
86 0.15
87 0.16
88 0.19
89 0.16
90 0.16
91 0.17
92 0.17
93 0.19
94 0.19
95 0.18
96 0.15
97 0.14
98 0.13
99 0.11
100 0.11
101 0.08
102 0.07
103 0.06
104 0.05
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.04
118 0.05
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.07
130 0.08
131 0.08
132 0.08
133 0.07
134 0.06
135 0.06
136 0.05
137 0.08
138 0.1
139 0.11
140 0.1
141 0.1
142 0.1
143 0.1
144 0.11
145 0.08
146 0.04
147 0.04
148 0.04
149 0.04
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.06
157 0.06
158 0.05
159 0.05
160 0.05
161 0.05
162 0.06
163 0.07
164 0.07
165 0.07
166 0.09
167 0.09
168 0.09
169 0.1
170 0.09
171 0.07
172 0.08
173 0.09
174 0.08
175 0.11
176 0.11
177 0.12
178 0.13
179 0.15
180 0.18
181 0.21
182 0.23
183 0.27
184 0.29
185 0.36
186 0.35
187 0.32
188 0.29
189 0.24
190 0.21
191 0.16
192 0.14
193 0.1
194 0.1
195 0.11
196 0.11
197 0.12
198 0.13
199 0.13
200 0.16
201 0.15
202 0.16
203 0.16
204 0.16
205 0.14
206 0.14
207 0.12
208 0.08
209 0.09
210 0.09
211 0.08
212 0.08
213 0.08
214 0.09
215 0.11
216 0.13
217 0.15
218 0.17
219 0.19
220 0.19
221 0.22
222 0.25
223 0.28
224 0.29
225 0.29
226 0.27
227 0.26
228 0.27
229 0.25
230 0.25
231 0.22
232 0.22
233 0.17
234 0.19
235 0.2
236 0.21
237 0.22
238 0.19
239 0.2
240 0.18
241 0.2
242 0.21
243 0.25
244 0.26
245 0.26
246 0.31
247 0.31
248 0.37
249 0.37
250 0.37
251 0.34
252 0.36
253 0.44
254 0.48
255 0.5
256 0.48
257 0.49
258 0.51
259 0.52
260 0.54
261 0.51
262 0.51
263 0.55
264 0.59
265 0.63
266 0.61
267 0.64
268 0.58
269 0.52
270 0.46
271 0.43
272 0.4
273 0.35