Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9TBF1

Protein Details
Accession A0A1L9TBF1    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-32SEISLPENKKNRYRSRKAFRQMRDRRREGIHydrophilic
NLS Segment(s)
PositionSequence
11-34KKNRYRSRKAFRQMRDRRREGIIK
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0006351  P:DNA-templated transcription  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
Amino Acid Sequences MASEISLPENKKNRYRSRKAFRQMRDRRREGIIKKANEYSKLCSADVCLGIRLRDSGRVYTFLADESGFWSSFESQVVAKTFPTPIRRTTEDFAPSHGTQHGSRESDTSNDNIGPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.79
3 0.82
4 0.84
5 0.88
6 0.91
7 0.91
8 0.88
9 0.89
10 0.89
11 0.89
12 0.89
13 0.83
14 0.76
15 0.73
16 0.73
17 0.65
18 0.65
19 0.63
20 0.56
21 0.55
22 0.57
23 0.53
24 0.5
25 0.48
26 0.42
27 0.4
28 0.39
29 0.36
30 0.29
31 0.28
32 0.25
33 0.24
34 0.19
35 0.14
36 0.12
37 0.12
38 0.12
39 0.12
40 0.1
41 0.13
42 0.14
43 0.15
44 0.15
45 0.17
46 0.17
47 0.17
48 0.16
49 0.12
50 0.11
51 0.09
52 0.08
53 0.07
54 0.08
55 0.08
56 0.07
57 0.08
58 0.08
59 0.09
60 0.09
61 0.08
62 0.07
63 0.1
64 0.12
65 0.11
66 0.11
67 0.12
68 0.14
69 0.18
70 0.24
71 0.24
72 0.27
73 0.33
74 0.37
75 0.41
76 0.42
77 0.44
78 0.44
79 0.42
80 0.41
81 0.41
82 0.37
83 0.34
84 0.32
85 0.29
86 0.24
87 0.29
88 0.31
89 0.27
90 0.28
91 0.28
92 0.28
93 0.27
94 0.29
95 0.25
96 0.22