Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9TWE0

Protein Details
Accession A0A1L9TWE0    Localization Confidence High Confidence Score 19.9
NoLS Segment(s)
PositionSequenceProtein Nature
148-168AEKRRQAAEKKREQREFRAKDBasic
NLS Segment(s)
PositionSequence
24-27KKRK
42-60RRKAQKIKADLIQKAKVKK
125-185RGGPGGRKNRKPKRSAFAKEMEIAEKRRQAAEKKREQREFRAKDRDAMVRAKRPDQYGKRR
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MAPKRPLEKAPSNKKSQLDPTANKKRKGFSVGPANLPDGTYRRKAQKIKADLIQKAKVKKEYAKVKAAELAAPQPKQFYLRREEEENKDEDGEDQVPEPASLELHPDRQAMVDSGEPAPEQVEGRGGPGGRKNRKPKRSAFAKEMEIAEKRRQAAEKKREQREFRAKDRDAMVRAKRPDQYGKRRLGRESHVLLSRVQRMVGESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.71
3 0.69
4 0.69
5 0.67
6 0.66
7 0.69
8 0.74
9 0.78
10 0.78
11 0.74
12 0.69
13 0.65
14 0.65
15 0.59
16 0.56
17 0.6
18 0.58
19 0.57
20 0.54
21 0.49
22 0.41
23 0.37
24 0.31
25 0.24
26 0.24
27 0.25
28 0.28
29 0.34
30 0.42
31 0.48
32 0.54
33 0.6
34 0.64
35 0.64
36 0.66
37 0.66
38 0.63
39 0.63
40 0.62
41 0.56
42 0.54
43 0.53
44 0.52
45 0.49
46 0.5
47 0.53
48 0.56
49 0.57
50 0.59
51 0.55
52 0.51
53 0.51
54 0.45
55 0.37
56 0.28
57 0.28
58 0.26
59 0.25
60 0.24
61 0.2
62 0.2
63 0.23
64 0.25
65 0.23
66 0.25
67 0.3
68 0.33
69 0.39
70 0.44
71 0.45
72 0.44
73 0.42
74 0.36
75 0.31
76 0.27
77 0.21
78 0.18
79 0.13
80 0.1
81 0.09
82 0.08
83 0.08
84 0.08
85 0.08
86 0.06
87 0.05
88 0.05
89 0.09
90 0.09
91 0.11
92 0.12
93 0.11
94 0.11
95 0.11
96 0.12
97 0.09
98 0.09
99 0.07
100 0.08
101 0.08
102 0.08
103 0.08
104 0.07
105 0.07
106 0.07
107 0.06
108 0.05
109 0.07
110 0.06
111 0.07
112 0.09
113 0.09
114 0.1
115 0.16
116 0.25
117 0.32
118 0.41
119 0.51
120 0.6
121 0.68
122 0.73
123 0.76
124 0.76
125 0.79
126 0.77
127 0.73
128 0.68
129 0.63
130 0.59
131 0.52
132 0.46
133 0.39
134 0.36
135 0.34
136 0.32
137 0.3
138 0.3
139 0.33
140 0.39
141 0.46
142 0.53
143 0.59
144 0.65
145 0.74
146 0.79
147 0.8
148 0.82
149 0.82
150 0.79
151 0.78
152 0.78
153 0.7
154 0.66
155 0.66
156 0.62
157 0.55
158 0.56
159 0.54
160 0.51
161 0.54
162 0.54
163 0.54
164 0.54
165 0.6
166 0.62
167 0.66
168 0.66
169 0.72
170 0.75
171 0.76
172 0.75
173 0.72
174 0.68
175 0.66
176 0.62
177 0.59
178 0.55
179 0.52
180 0.5
181 0.49
182 0.49
183 0.41
184 0.36
185 0.3