Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9T3K4

Protein Details
Accession A0A1L9T3K4   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
423-442DDPLKKPYYRKFRLNGNDFHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 6, nucl 2, cyto 2, extr 2, cyto_nucl 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
GO:0048856  P:anatomical structure development  
GO:0043934  P:sporulation  
Pfam View protein in Pfam  
PF13641  Glyco_tranf_2_3  
CDD cd06434  GT2_HAS  
Amino Acid Sequences MHITYMRAFIALFFYRYFRLVVNLVSFWTFKPITPPENPRLTADDVTVIIPTLDGCGEELERTIETILTNRPFELLLVTIEANKKKAEGMLSRMPAAKSRIRLFTVTHPNKRRQMTRAIPEVQTAITIFADDDVIWPPKVLSWMLAPFEKDERYGGVVTCQRLQRAISPTLSQRIWGFLGALYLERRNFDCAATTHIDGGLPCMSGRTVAYKTSILQDDAFTYAFTNEGWWFGKYQLNADDDNFITRWMVSHGWETFMQYHPEAEVQTTLEDNPTFLKQCARWSRSNWRSNLTSMFDEGHIWHRQLWSAYAVHMTTLSPPALLGDLALIFLCHKATASWDEHSHALAMSLLAVWMFVSKFIKLLGHYIRFPIDWVFLPVSILFGYFHGAIKMYAVMTLSATTWGSREGADDFDAERMKRRPDDDPLKKPYYRKFRLNGNDFHHRLVPSVTAADIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.22
4 0.23
5 0.17
6 0.19
7 0.19
8 0.21
9 0.22
10 0.21
11 0.21
12 0.22
13 0.22
14 0.18
15 0.23
16 0.21
17 0.17
18 0.25
19 0.3
20 0.34
21 0.42
22 0.5
23 0.51
24 0.58
25 0.59
26 0.54
27 0.53
28 0.51
29 0.45
30 0.38
31 0.32
32 0.25
33 0.23
34 0.2
35 0.15
36 0.1
37 0.09
38 0.08
39 0.06
40 0.06
41 0.05
42 0.06
43 0.07
44 0.08
45 0.08
46 0.09
47 0.1
48 0.1
49 0.1
50 0.1
51 0.09
52 0.09
53 0.12
54 0.18
55 0.2
56 0.21
57 0.2
58 0.21
59 0.2
60 0.2
61 0.18
62 0.13
63 0.1
64 0.11
65 0.11
66 0.14
67 0.19
68 0.2
69 0.2
70 0.19
71 0.19
72 0.18
73 0.21
74 0.24
75 0.23
76 0.28
77 0.35
78 0.36
79 0.38
80 0.4
81 0.38
82 0.36
83 0.37
84 0.34
85 0.33
86 0.36
87 0.38
88 0.38
89 0.39
90 0.38
91 0.43
92 0.5
93 0.52
94 0.57
95 0.59
96 0.65
97 0.71
98 0.74
99 0.71
100 0.64
101 0.65
102 0.65
103 0.65
104 0.66
105 0.62
106 0.56
107 0.51
108 0.47
109 0.36
110 0.28
111 0.2
112 0.13
113 0.09
114 0.08
115 0.07
116 0.06
117 0.06
118 0.06
119 0.06
120 0.08
121 0.1
122 0.1
123 0.1
124 0.1
125 0.1
126 0.12
127 0.11
128 0.1
129 0.11
130 0.14
131 0.16
132 0.17
133 0.17
134 0.17
135 0.19
136 0.19
137 0.16
138 0.14
139 0.13
140 0.14
141 0.15
142 0.13
143 0.16
144 0.18
145 0.19
146 0.23
147 0.23
148 0.21
149 0.22
150 0.23
151 0.24
152 0.26
153 0.27
154 0.25
155 0.26
156 0.28
157 0.31
158 0.3
159 0.25
160 0.19
161 0.18
162 0.17
163 0.15
164 0.13
165 0.08
166 0.09
167 0.08
168 0.09
169 0.08
170 0.09
171 0.1
172 0.1
173 0.11
174 0.13
175 0.14
176 0.13
177 0.14
178 0.13
179 0.18
180 0.19
181 0.18
182 0.16
183 0.15
184 0.15
185 0.12
186 0.14
187 0.09
188 0.07
189 0.06
190 0.06
191 0.06
192 0.06
193 0.07
194 0.09
195 0.09
196 0.1
197 0.12
198 0.12
199 0.13
200 0.16
201 0.17
202 0.14
203 0.13
204 0.13
205 0.12
206 0.12
207 0.12
208 0.08
209 0.08
210 0.07
211 0.06
212 0.06
213 0.06
214 0.05
215 0.07
216 0.08
217 0.08
218 0.09
219 0.1
220 0.13
221 0.12
222 0.14
223 0.16
224 0.17
225 0.17
226 0.17
227 0.17
228 0.15
229 0.16
230 0.14
231 0.1
232 0.08
233 0.08
234 0.07
235 0.07
236 0.08
237 0.08
238 0.11
239 0.11
240 0.13
241 0.13
242 0.15
243 0.15
244 0.16
245 0.16
246 0.13
247 0.13
248 0.12
249 0.12
250 0.11
251 0.1
252 0.08
253 0.07
254 0.07
255 0.08
256 0.07
257 0.08
258 0.07
259 0.07
260 0.08
261 0.09
262 0.1
263 0.1
264 0.14
265 0.14
266 0.23
267 0.33
268 0.36
269 0.39
270 0.44
271 0.55
272 0.61
273 0.67
274 0.61
275 0.56
276 0.53
277 0.51
278 0.49
279 0.41
280 0.32
281 0.26
282 0.25
283 0.2
284 0.19
285 0.17
286 0.18
287 0.16
288 0.16
289 0.17
290 0.16
291 0.18
292 0.18
293 0.18
294 0.16
295 0.14
296 0.14
297 0.14
298 0.14
299 0.12
300 0.12
301 0.1
302 0.09
303 0.11
304 0.1
305 0.08
306 0.08
307 0.08
308 0.08
309 0.08
310 0.06
311 0.05
312 0.05
313 0.05
314 0.05
315 0.04
316 0.04
317 0.05
318 0.05
319 0.04
320 0.05
321 0.05
322 0.08
323 0.13
324 0.16
325 0.19
326 0.2
327 0.22
328 0.23
329 0.23
330 0.2
331 0.15
332 0.12
333 0.09
334 0.08
335 0.06
336 0.05
337 0.05
338 0.04
339 0.04
340 0.03
341 0.04
342 0.04
343 0.06
344 0.08
345 0.08
346 0.09
347 0.1
348 0.12
349 0.11
350 0.18
351 0.24
352 0.26
353 0.27
354 0.29
355 0.3
356 0.28
357 0.28
358 0.23
359 0.18
360 0.15
361 0.18
362 0.17
363 0.15
364 0.16
365 0.15
366 0.14
367 0.12
368 0.11
369 0.08
370 0.07
371 0.1
372 0.1
373 0.1
374 0.1
375 0.1
376 0.1
377 0.1
378 0.11
379 0.09
380 0.09
381 0.09
382 0.08
383 0.08
384 0.09
385 0.08
386 0.09
387 0.09
388 0.09
389 0.09
390 0.1
391 0.1
392 0.1
393 0.11
394 0.11
395 0.13
396 0.13
397 0.14
398 0.14
399 0.17
400 0.21
401 0.19
402 0.25
403 0.27
404 0.33
405 0.37
406 0.4
407 0.42
408 0.5
409 0.61
410 0.64
411 0.69
412 0.72
413 0.74
414 0.75
415 0.76
416 0.75
417 0.75
418 0.73
419 0.73
420 0.7
421 0.74
422 0.8
423 0.81
424 0.79
425 0.76
426 0.78
427 0.7
428 0.67
429 0.62
430 0.51
431 0.45
432 0.38
433 0.33
434 0.24
435 0.24