Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0VFX6

Protein Details
Accession G0VFX6    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-22AQRVTFRRRNPYNTKSNKIKVHydrophilic
NLS Segment(s)
PositionSequence
111-125AAKKAEKKDAKKSKK
Subcellular Location(s) mito 20, cyto 4, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ncs:NCAS_0E03250  -  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTFRRRNPYNTKSNKIKVVKTPGGILRAQHVKKQASRPKCGDCGIPLPGVAALRPRQYASISKTSKTVSRVYGGSRCSNCVKERIVRAFLIEEQKIVKKVVKEQTEAAKKAEKKDAKKSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.81
4 0.79
5 0.79
6 0.76
7 0.73
8 0.7
9 0.71
10 0.67
11 0.58
12 0.57
13 0.51
14 0.48
15 0.43
16 0.35
17 0.31
18 0.35
19 0.35
20 0.33
21 0.36
22 0.38
23 0.42
24 0.52
25 0.55
26 0.53
27 0.6
28 0.62
29 0.61
30 0.6
31 0.55
32 0.47
33 0.41
34 0.37
35 0.31
36 0.26
37 0.2
38 0.16
39 0.15
40 0.13
41 0.11
42 0.1
43 0.1
44 0.12
45 0.12
46 0.12
47 0.13
48 0.15
49 0.19
50 0.2
51 0.28
52 0.28
53 0.28
54 0.29
55 0.3
56 0.31
57 0.3
58 0.28
59 0.21
60 0.22
61 0.23
62 0.24
63 0.27
64 0.27
65 0.3
66 0.28
67 0.29
68 0.3
69 0.32
70 0.31
71 0.31
72 0.32
73 0.32
74 0.38
75 0.4
76 0.4
77 0.36
78 0.36
79 0.34
80 0.34
81 0.34
82 0.26
83 0.22
84 0.22
85 0.25
86 0.25
87 0.24
88 0.24
89 0.21
90 0.3
91 0.38
92 0.4
93 0.4
94 0.43
95 0.52
96 0.57
97 0.56
98 0.51
99 0.5
100 0.49
101 0.52
102 0.58
103 0.56
104 0.55
105 0.64