Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SXQ6

Protein Details
Accession A0A1L9SXQ6    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
103-129QEPIRSREPKPKARRGLPHRRDQKRDSBasic
NLS Segment(s)
PositionSequence
107-127RSREPKPKARRGLPHRRDQKR
Subcellular Location(s) nucl 12.5, cyto_nucl 11.5, cyto 7.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR022198  DUF3723  
Pfam View protein in Pfam  
PF12520  DUF3723  
Amino Acid Sequences MRHYPKIPRPSGGDDLVAKPDCEKADDTVLHGLAVLAQRLGFNSPHIQQLAEQSPDRQIARDVLLKARPPGHYRFNGGTFESLVTRVCGCFSEAIPIDQQASQEPIRSREPKPKARRGLPHRRDQKRDSRFLFLDNLHSSDLQLGGKVTTFFVRQCVYSAFFGRLPDSSPVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.4
3 0.42
4 0.36
5 0.29
6 0.24
7 0.26
8 0.23
9 0.22
10 0.22
11 0.18
12 0.24
13 0.24
14 0.26
15 0.25
16 0.25
17 0.22
18 0.2
19 0.17
20 0.13
21 0.13
22 0.11
23 0.07
24 0.07
25 0.08
26 0.08
27 0.1
28 0.08
29 0.1
30 0.14
31 0.15
32 0.18
33 0.19
34 0.18
35 0.17
36 0.23
37 0.24
38 0.24
39 0.23
40 0.2
41 0.23
42 0.26
43 0.25
44 0.2
45 0.17
46 0.16
47 0.18
48 0.21
49 0.2
50 0.21
51 0.23
52 0.24
53 0.25
54 0.27
55 0.27
56 0.26
57 0.3
58 0.33
59 0.32
60 0.34
61 0.35
62 0.33
63 0.32
64 0.29
65 0.25
66 0.19
67 0.17
68 0.13
69 0.11
70 0.08
71 0.07
72 0.07
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.07
79 0.11
80 0.11
81 0.12
82 0.12
83 0.12
84 0.12
85 0.12
86 0.12
87 0.08
88 0.11
89 0.11
90 0.15
91 0.16
92 0.18
93 0.24
94 0.28
95 0.31
96 0.37
97 0.46
98 0.52
99 0.6
100 0.67
101 0.69
102 0.73
103 0.8
104 0.8
105 0.83
106 0.81
107 0.81
108 0.82
109 0.82
110 0.82
111 0.79
112 0.79
113 0.77
114 0.79
115 0.72
116 0.69
117 0.61
118 0.56
119 0.53
120 0.44
121 0.41
122 0.34
123 0.32
124 0.25
125 0.24
126 0.22
127 0.18
128 0.19
129 0.12
130 0.11
131 0.09
132 0.09
133 0.1
134 0.1
135 0.1
136 0.11
137 0.12
138 0.12
139 0.16
140 0.17
141 0.17
142 0.19
143 0.21
144 0.22
145 0.24
146 0.26
147 0.25
148 0.25
149 0.26
150 0.26
151 0.23
152 0.23