Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SXN2

Protein Details
Accession A0A1L9SXN2   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
60-88KTGSRCYYEPNKDKRRKEALKDAQQTKKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MAHRGTKVSFQPLLPATKFIPVNDQQASHQKRKRQTVACAPCQTKRTKCSGSSPCVSCTKTGSRCYYEPNKDKRRKEALKDAQQTKKALIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.27
4 0.3
5 0.31
6 0.26
7 0.29
8 0.27
9 0.31
10 0.3
11 0.3
12 0.26
13 0.36
14 0.41
15 0.43
16 0.45
17 0.46
18 0.52
19 0.6
20 0.67
21 0.63
22 0.64
23 0.66
24 0.69
25 0.71
26 0.7
27 0.63
28 0.58
29 0.56
30 0.54
31 0.48
32 0.44
33 0.43
34 0.4
35 0.41
36 0.46
37 0.49
38 0.49
39 0.49
40 0.48
41 0.44
42 0.44
43 0.43
44 0.34
45 0.31
46 0.34
47 0.34
48 0.38
49 0.4
50 0.4
51 0.41
52 0.48
53 0.54
54 0.56
55 0.59
56 0.64
57 0.7
58 0.74
59 0.79
60 0.81
61 0.82
62 0.81
63 0.81
64 0.81
65 0.81
66 0.83
67 0.86
68 0.86
69 0.83
70 0.8
71 0.73