Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9T9Q9

Protein Details
Accession A0A1L9T9Q9    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
35-60FTHTRTCRRCSQKKIRYNKHQPCDSCHydrophilic
67-90CVFPGPSRAPRRRKQPLKAQFLSHHydrophilic
NLS Segment(s)
PositionSequence
76-80PRRRK
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
Amino Acid Sequences MDSPGIVTHKSLTSKFFFPSHWQESNMYMGRMENFTHTRTCRRCSQKKIRYNKHQPCDSCSRSGSACVFPGPSRAPRRRKQPLKAQFLSHLKSLEEESAGSYSAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.3
4 0.28
5 0.32
6 0.39
7 0.42
8 0.4
9 0.4
10 0.38
11 0.39
12 0.43
13 0.37
14 0.29
15 0.22
16 0.2
17 0.19
18 0.19
19 0.17
20 0.15
21 0.15
22 0.17
23 0.21
24 0.22
25 0.3
26 0.33
27 0.36
28 0.41
29 0.49
30 0.56
31 0.63
32 0.72
33 0.73
34 0.78
35 0.85
36 0.86
37 0.87
38 0.89
39 0.88
40 0.84
41 0.81
42 0.73
43 0.67
44 0.66
45 0.58
46 0.5
47 0.42
48 0.35
49 0.3
50 0.31
51 0.28
52 0.2
53 0.18
54 0.15
55 0.16
56 0.14
57 0.18
58 0.18
59 0.24
60 0.32
61 0.4
62 0.49
63 0.55
64 0.65
65 0.72
66 0.79
67 0.81
68 0.82
69 0.83
70 0.85
71 0.81
72 0.75
73 0.72
74 0.7
75 0.63
76 0.55
77 0.46
78 0.36
79 0.34
80 0.32
81 0.25
82 0.18
83 0.16
84 0.15
85 0.14