Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9SYQ0

Protein Details
Accession A0A1L9SYQ0    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MVSSQNRTKQEQIRKRRNNLLRRHNDFWRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 12.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MVSSQNRTKQEQIRKRRNNLLRRHNDFWRLYAIRSWTTLEMPNGRIYTYRSHPQIPAPTDREMRERSQPAVHKTPADYGPPGLIDMVLPALPSLRVRGRRSQLWDLLSTEPERAWS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.87
4 0.88
5 0.86
6 0.86
7 0.86
8 0.86
9 0.84
10 0.81
11 0.77
12 0.75
13 0.67
14 0.59
15 0.56
16 0.47
17 0.39
18 0.37
19 0.34
20 0.27
21 0.27
22 0.27
23 0.2
24 0.2
25 0.21
26 0.21
27 0.2
28 0.2
29 0.22
30 0.2
31 0.19
32 0.18
33 0.18
34 0.2
35 0.21
36 0.25
37 0.25
38 0.26
39 0.27
40 0.3
41 0.35
42 0.33
43 0.34
44 0.31
45 0.32
46 0.32
47 0.33
48 0.33
49 0.3
50 0.3
51 0.31
52 0.3
53 0.29
54 0.33
55 0.36
56 0.38
57 0.41
58 0.4
59 0.34
60 0.33
61 0.36
62 0.32
63 0.3
64 0.24
65 0.18
66 0.18
67 0.17
68 0.16
69 0.11
70 0.09
71 0.06
72 0.06
73 0.06
74 0.05
75 0.05
76 0.04
77 0.05
78 0.06
79 0.06
80 0.1
81 0.17
82 0.25
83 0.29
84 0.39
85 0.45
86 0.51
87 0.59
88 0.63
89 0.62
90 0.57
91 0.56
92 0.5
93 0.46
94 0.42
95 0.35
96 0.29