Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0VKM0

Protein Details
Accession G0VKM0   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-39AAMAGGKKSKKKWSKNNHKDKAAHAHydrophilic
NLS Segment(s)
PositionSequence
12-34KAAAAMAGGKKSKKKWSKNNHKD
Subcellular Location(s) mito 15, nucl 7.5, cyto_nucl 6.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG ncs:NCAS_0J00780  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKQQLSKAAKAAAAMAGGKKSKKKWSKNNHKDKAAHAVILDQEKLDRIMKEVPTYRYVSVSVLVDRLKIGGSMARVALRDLEKQGIIVPVSKHSKQAIYTRAVSSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.24
3 0.17
4 0.14
5 0.15
6 0.17
7 0.21
8 0.25
9 0.3
10 0.39
11 0.48
12 0.57
13 0.64
14 0.73
15 0.81
16 0.86
17 0.92
18 0.91
19 0.89
20 0.82
21 0.74
22 0.73
23 0.62
24 0.52
25 0.4
26 0.32
27 0.26
28 0.25
29 0.21
30 0.11
31 0.1
32 0.1
33 0.11
34 0.11
35 0.09
36 0.1
37 0.14
38 0.14
39 0.18
40 0.21
41 0.22
42 0.24
43 0.26
44 0.24
45 0.21
46 0.21
47 0.18
48 0.15
49 0.14
50 0.11
51 0.11
52 0.11
53 0.1
54 0.09
55 0.09
56 0.08
57 0.07
58 0.07
59 0.06
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.11
66 0.14
67 0.14
68 0.16
69 0.16
70 0.18
71 0.17
72 0.17
73 0.18
74 0.17
75 0.15
76 0.16
77 0.16
78 0.21
79 0.28
80 0.28
81 0.31
82 0.31
83 0.34
84 0.35
85 0.42
86 0.41
87 0.41
88 0.44