FuNGI

A0A1L9TTV9

Protein Details

Accession

A0A1L9TTV9

Localization Confidence

Medium

Confidence Score

12.3

NoLS Segment(s)

Position	Sequence	Protein Nature
483-512	GISRTWRYLKAKQDKWKNSGKKEPEPSEES	Hydrophilic

NLS Segment(s)

Position	Sequence
497-508	KWKNSGKKEPEP
513-518	PKEHKK

Subcellular Location(s)

mito 16, nucl 6, cyto 4

Family & Domain DBs

InterPro	View protein in InterPro IPR015222 Tam41
Gene Ontology	GO:0005743 C:mitochondrial inner membrane GO:0004605 F:phosphatidate cytidylyltransferase activity GO:0032049 P:cardiolipin biosynthetic process GO:0016024 P:CDP-diacylglycerol biosynthetic process
Pfam	View protein in Pfam PF09139 Tam41_Mmp37

Amino Acid Sequences

MRETTLLFSNAASGPYVRLRSTYPVIPRYTRRQGSFRYFSSERNAIHPRNAGLTTPGHRSPSYSSAGVQHTCPDGGLLTPSSAPFSTSSRALDTGDWDANPNLAISAFSELPSKDFGINQHMVINQEFKEALRQILWQFRAPIRYAFAYGSGVFPQHGSAPGSEQCHPSAPAAIQNMQQGKGKMIDFIFGVSYSQHWHSLNLAQHRDHYSGLRSLGSYTVSQVQDRFGAGVYFNPYITVNGTLIKYGVVNIDTLCQDLSQWDTLYLAGRLQKPVKILRDHPKVRLANQMNLLSALRVALLLLPEQFTEFQLYNTIASISYMGDLRMALPVEDPKKVNNIVSSQMANFRRLYAPLIENLPNAVFNDSRCSSEDWIDDPEANVRLTQDMDPVKRGNMVRRLPESFRDRLYFQYQTRFEIPRAEFMKMMEESNDKDPELVRRRQGGPFEQRIASDEGLTKEIQGAITKTIRWPSSVETVKGLFTAGISRTWRYLKAKQDKWKNSGKKEPEPSEESPKEHKKE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.16
2	0.21
3	0.24
4	0.21
5	0.22
6	0.24
7	0.29
8	0.34
9	0.37
10	0.39
11	0.44
12	0.49
13	0.53
14	0.58
15	0.61
16	0.67
17	0.68
18	0.65
19	0.66
20	0.7
21	0.73
22	0.73
23	0.66
24	0.64
25	0.58
26	0.56
27	0.56
28	0.54
29	0.45
30	0.45
31	0.52
32	0.46
33	0.49
34	0.5
35	0.43
36	0.41
37	0.41
38	0.34
39	0.29
40	0.31
41	0.29
42	0.32
43	0.33
44	0.32
45	0.31
46	0.33
47	0.35
48	0.35
49	0.36
50	0.31
51	0.29
52	0.31
53	0.36
54	0.35
55	0.3
56	0.28
57	0.25
58	0.24
59	0.22
60	0.17
61	0.12
62	0.11
63	0.13
64	0.11
65	0.1
66	0.11
67	0.11
68	0.13
69	0.13
70	0.13
71	0.13
72	0.15
73	0.17
74	0.19
75	0.2
76	0.2
77	0.21
78	0.21
79	0.2
80	0.2
81	0.22
82	0.21
83	0.2
84	0.19
85	0.18
86	0.17
87	0.17
88	0.14
89	0.09
90	0.07
91	0.07
92	0.06
93	0.09
94	0.09
95	0.1
96	0.12
97	0.12
98	0.13
99	0.15
100	0.15
101	0.13
102	0.14
103	0.16
104	0.21
105	0.23
106	0.22
107	0.22
108	0.22
109	0.23
110	0.23
111	0.24
112	0.16
113	0.16
114	0.16
115	0.14
116	0.18
117	0.17
118	0.17
119	0.15
120	0.18
121	0.2
122	0.27
123	0.29
124	0.25
125	0.28
126	0.3
127	0.32
128	0.31
129	0.3
130	0.25
131	0.24
132	0.24
133	0.2
134	0.19
135	0.17
136	0.16
137	0.15
138	0.13
139	0.12
140	0.1
141	0.1
142	0.1
143	0.09
144	0.1
145	0.1
146	0.1
147	0.13
148	0.16
149	0.19
150	0.2
151	0.21
152	0.2
153	0.21
154	0.22
155	0.19
156	0.18
157	0.15
158	0.17
159	0.18
160	0.19
161	0.19
162	0.22
163	0.23
164	0.23
165	0.25
166	0.21
167	0.2
168	0.22
169	0.2
170	0.18
171	0.17
172	0.16
173	0.13
174	0.13
175	0.12
176	0.09
177	0.09
178	0.06
179	0.07
180	0.08
181	0.09
182	0.12
183	0.12
184	0.12
185	0.14
186	0.19
187	0.23
188	0.27
189	0.29
190	0.26
191	0.29
192	0.32
193	0.31
194	0.27
195	0.24
196	0.2
197	0.19
198	0.2
199	0.17
200	0.14
201	0.13
202	0.13
203	0.13
204	0.11
205	0.1
206	0.15
207	0.15
208	0.15
209	0.15
210	0.15
211	0.14
212	0.14
213	0.13
214	0.07
215	0.07
216	0.07
217	0.08
218	0.1
219	0.1
220	0.1
221	0.1
222	0.1
223	0.1
224	0.11
225	0.1
226	0.07
227	0.09
228	0.09
229	0.08
230	0.08
231	0.08
232	0.07
233	0.06
234	0.07
235	0.05
236	0.05
237	0.05
238	0.07
239	0.07
240	0.07
241	0.07
242	0.06
243	0.05
244	0.06
245	0.07
246	0.06
247	0.06
248	0.06
249	0.06
250	0.07
251	0.08
252	0.07
253	0.07
254	0.1
255	0.11
256	0.15
257	0.16
258	0.17
259	0.19
260	0.24
261	0.28
262	0.27
263	0.33
264	0.41
265	0.5
266	0.51
267	0.51
268	0.55
269	0.51
270	0.5
271	0.53
272	0.45
273	0.39
274	0.41
275	0.39
276	0.3
277	0.29
278	0.27
279	0.17
280	0.14
281	0.1
282	0.05
283	0.04
284	0.04
285	0.04
286	0.04
287	0.04
288	0.05
289	0.05
290	0.05
291	0.06
292	0.07
293	0.06
294	0.09
295	0.08
296	0.08
297	0.1
298	0.1
299	0.09
300	0.09
301	0.09
302	0.07
303	0.07
304	0.07
305	0.05
306	0.06
307	0.06
308	0.06
309	0.05
310	0.05
311	0.06
312	0.07
313	0.07
314	0.06
315	0.07
316	0.12
317	0.13
318	0.16
319	0.16
320	0.16
321	0.2
322	0.21
323	0.22
324	0.19
325	0.2
326	0.2
327	0.22
328	0.22
329	0.18
330	0.25
331	0.25
332	0.25
333	0.23
334	0.22
335	0.21
336	0.21
337	0.22
338	0.19
339	0.19
340	0.18
341	0.22
342	0.21
343	0.19
344	0.19
345	0.18
346	0.14
347	0.13
348	0.13
349	0.1
350	0.1
351	0.16
352	0.16
353	0.18
354	0.19
355	0.21
356	0.21
357	0.24
358	0.25
359	0.21
360	0.23
361	0.22
362	0.21
363	0.18
364	0.19
365	0.17
366	0.16
367	0.14
368	0.11
369	0.11
370	0.13
371	0.13
372	0.16
373	0.19
374	0.21
375	0.24
376	0.24
377	0.24
378	0.28
379	0.3
380	0.32
381	0.36
382	0.4
383	0.43
384	0.47
385	0.51
386	0.48
387	0.54
388	0.52
389	0.47
390	0.46
391	0.43
392	0.39
393	0.39
394	0.42
395	0.41
396	0.38
397	0.44
398	0.41
399	0.43
400	0.47
401	0.44
402	0.39
403	0.41
404	0.4
405	0.39
406	0.4
407	0.37
408	0.33
409	0.3
410	0.35
411	0.27
412	0.27
413	0.21
414	0.2
415	0.22
416	0.26
417	0.28
418	0.22
419	0.22
420	0.23
421	0.3
422	0.36
423	0.39
424	0.39
425	0.44
426	0.48
427	0.52
428	0.57
429	0.56
430	0.58
431	0.59
432	0.58
433	0.52
434	0.49
435	0.47
436	0.45
437	0.36
438	0.29
439	0.25
440	0.22
441	0.23
442	0.23
443	0.19
444	0.17
445	0.17
446	0.16
447	0.15
448	0.14
449	0.18
450	0.2
451	0.21
452	0.24
453	0.29
454	0.29
455	0.28
456	0.29
457	0.28
458	0.36
459	0.4
460	0.38
461	0.35
462	0.35
463	0.34
464	0.32
465	0.28
466	0.18
467	0.13
468	0.16
469	0.13
470	0.17
471	0.19
472	0.21
473	0.25
474	0.28
475	0.35
476	0.38
477	0.44
478	0.5
479	0.58
480	0.66
481	0.71
482	0.8
483	0.82
484	0.82
485	0.85
486	0.84
487	0.83
488	0.85
489	0.84
490	0.83
491	0.84
492	0.84
493	0.81
494	0.78
495	0.74
496	0.74
497	0.69
498	0.64
499	0.64

A0A1L9TTV9

3D AlphaFold-predicted Structure Viewer