Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1L9TKD3

Protein Details
Accession A0A1L9TKD3    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
18-41LWLVVLWRSRKKRARAKTSEEAQEHydrophilic
NLS Segment(s)
PositionSequence
27-33RKKRARA
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001931  Ribosomal_S21e  
IPR038579  Ribosomal_S21e_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01249  Ribosomal_S21e  
Amino Acid Sequences MNEFSFRAAFQSDCLSSLWLVVLWRSRKKRARAKTSEEAQEAKQPSINPLTFLFSSSYVPRKCSATNRIIKANDHASVQISIGKVDENGRYTGENQTYALCGFIRARGESDDSFNRLTQRDGYIRNVWTASRQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.15
4 0.15
5 0.14
6 0.09
7 0.09
8 0.1
9 0.17
10 0.22
11 0.31
12 0.37
13 0.46
14 0.54
15 0.63
16 0.72
17 0.76
18 0.8
19 0.8
20 0.83
21 0.83
22 0.82
23 0.78
24 0.71
25 0.62
26 0.53
27 0.5
28 0.43
29 0.34
30 0.29
31 0.23
32 0.23
33 0.26
34 0.25
35 0.2
36 0.19
37 0.22
38 0.19
39 0.2
40 0.19
41 0.13
42 0.15
43 0.16
44 0.22
45 0.19
46 0.21
47 0.21
48 0.22
49 0.23
50 0.28
51 0.33
52 0.35
53 0.41
54 0.42
55 0.46
56 0.45
57 0.43
58 0.4
59 0.36
60 0.28
61 0.22
62 0.2
63 0.15
64 0.14
65 0.14
66 0.13
67 0.1
68 0.09
69 0.09
70 0.08
71 0.08
72 0.1
73 0.11
74 0.11
75 0.12
76 0.13
77 0.14
78 0.15
79 0.2
80 0.19
81 0.18
82 0.16
83 0.16
84 0.16
85 0.15
86 0.15
87 0.09
88 0.09
89 0.09
90 0.12
91 0.14
92 0.14
93 0.16
94 0.17
95 0.21
96 0.21
97 0.26
98 0.26
99 0.27
100 0.28
101 0.28
102 0.29
103 0.26
104 0.27
105 0.25
106 0.27
107 0.3
108 0.32
109 0.37
110 0.4
111 0.4
112 0.41
113 0.39
114 0.33