Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0V780

Protein Details
Accession G0V780    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
65-85TVFDERRKKGRKNKNVTLCAYHydrophilic
NLS Segment(s)
PositionSequence
70-77RRKKGRKN
Subcellular Location(s) nucl 14.5, cyto_nucl 13.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
KEGG ncs:NCAS_0A07700  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd00590  RRM_SF  
Amino Acid Sequences MVEASNKLGDVPIHFATTEEEKKSRQHEIDSRSVFIKGLHQDITPNEIESYFNTIGCGDAILRITVFDERRKKGRKNKNVTLCAYVEFQSLESHTRALELNECVFDGGMLRVFKKRTNLPASKRHNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.19
4 0.25
5 0.28
6 0.26
7 0.27
8 0.28
9 0.33
10 0.37
11 0.42
12 0.37
13 0.41
14 0.44
15 0.48
16 0.56
17 0.53
18 0.5
19 0.44
20 0.41
21 0.34
22 0.27
23 0.26
24 0.19
25 0.19
26 0.19
27 0.18
28 0.2
29 0.2
30 0.23
31 0.18
32 0.16
33 0.13
34 0.13
35 0.13
36 0.12
37 0.18
38 0.14
39 0.13
40 0.13
41 0.12
42 0.12
43 0.11
44 0.11
45 0.04
46 0.05
47 0.05
48 0.05
49 0.05
50 0.04
51 0.05
52 0.08
53 0.1
54 0.15
55 0.21
56 0.24
57 0.33
58 0.4
59 0.48
60 0.56
61 0.65
62 0.69
63 0.73
64 0.8
65 0.82
66 0.82
67 0.76
68 0.7
69 0.6
70 0.51
71 0.42
72 0.33
73 0.24
74 0.17
75 0.15
76 0.11
77 0.12
78 0.12
79 0.11
80 0.11
81 0.1
82 0.11
83 0.11
84 0.12
85 0.14
86 0.14
87 0.15
88 0.15
89 0.15
90 0.14
91 0.13
92 0.12
93 0.09
94 0.08
95 0.11
96 0.11
97 0.13
98 0.18
99 0.2
100 0.24
101 0.3
102 0.36
103 0.42
104 0.51
105 0.59
106 0.63
107 0.71