Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9TC75

Protein Details
Accession A0A1L9TC75   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
86-123PYAGADRSTCRRRRHCQRHGRTWPKPTRPKLREHSGGKBasic
NLS Segment(s)
PositionSequence
103-123RHGRTWPKPTRPKLREHSGGK
Subcellular Location(s) mito 9, extr 6, cyto_mito 6, nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSHRSSLPGEASFLLYLQATLSWGKTLRYWGDFLPRTRFQYLGTIPPTLPCYGIRPSSNISKIYIYLFVHHITPIIFLTLPISPYPYAGADRSTCRRRRHCQRHGRTWPKPTRPKLREHSGGKTKGHMLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.1
4 0.08
5 0.07
6 0.07
7 0.07
8 0.08
9 0.09
10 0.1
11 0.11
12 0.13
13 0.17
14 0.19
15 0.21
16 0.22
17 0.22
18 0.31
19 0.34
20 0.36
21 0.39
22 0.4
23 0.42
24 0.41
25 0.4
26 0.32
27 0.35
28 0.33
29 0.32
30 0.3
31 0.27
32 0.26
33 0.26
34 0.27
35 0.2
36 0.19
37 0.13
38 0.14
39 0.16
40 0.19
41 0.19
42 0.19
43 0.21
44 0.26
45 0.28
46 0.25
47 0.24
48 0.21
49 0.21
50 0.2
51 0.2
52 0.14
53 0.13
54 0.13
55 0.13
56 0.12
57 0.11
58 0.11
59 0.08
60 0.08
61 0.07
62 0.06
63 0.06
64 0.05
65 0.07
66 0.07
67 0.08
68 0.07
69 0.09
70 0.08
71 0.09
72 0.1
73 0.1
74 0.11
75 0.1
76 0.13
77 0.13
78 0.18
79 0.26
80 0.34
81 0.4
82 0.48
83 0.57
84 0.65
85 0.75
86 0.81
87 0.84
88 0.86
89 0.89
90 0.92
91 0.94
92 0.94
93 0.91
94 0.9
95 0.9
96 0.89
97 0.89
98 0.88
99 0.88
100 0.82
101 0.84
102 0.82
103 0.81
104 0.8
105 0.77
106 0.77
107 0.76
108 0.78
109 0.7
110 0.65