Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1L9TIQ9

Protein Details
Accession A0A1L9TIQ9   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
235-255QTMNRRQKRMMDRENRKEKKNBasic
378-397SAAASGKASRRRKGKRSQRSHydrophilic
NLS Segment(s)
PositionSequence
246-256DRENRKEKKNG
383-397GKASRRRKGKRSQRS
Subcellular Location(s) extr 12, mito 4, golg 4, E.R. 3, plas 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Gene Ontology GO:0016020  C:membrane  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MKTAALRLVLLAVLSVLAAAWSKEDYEIFRLHDEVTAAEGAGVTFYDFVGAQPNANQNDLNKAYRKTSRLLHPDKVKRSFIANASKDQDRSKTTQKGVHVNRGPTKREIAAAEKEAHERAQRLNVVANILRGPGRERYDYFLKNGFPKWRGTGYYYSRFRPGLGSVLVGLLLAFGGGAHYGALILSWKRQRDFVDRYIRQARRAAWGDELGVRGINSTPTPASAPAADSGEMSAQTMNRRQKRMMDRENRKEKKNGGSKTGSRSTGTSSPTGETVEPTGERKRVVAENGKVLIVDSVGNVFLEEESEDGERQEFLLDVEEIQRPTVRDTMIFKLPGWVYRKTVGQVLGTSNMVDDGTFSEGEEMDVMEQPEQSEQSGSAAASGKASRRRKGKRSQRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.03
4 0.03
5 0.04
6 0.04
7 0.05
8 0.06
9 0.07
10 0.08
11 0.1
12 0.13
13 0.17
14 0.2
15 0.21
16 0.22
17 0.23
18 0.22
19 0.22
20 0.2
21 0.16
22 0.16
23 0.14
24 0.12
25 0.11
26 0.1
27 0.08
28 0.07
29 0.07
30 0.05
31 0.04
32 0.04
33 0.05
34 0.05
35 0.06
36 0.12
37 0.12
38 0.12
39 0.16
40 0.23
41 0.24
42 0.25
43 0.26
44 0.2
45 0.29
46 0.32
47 0.34
48 0.32
49 0.33
50 0.38
51 0.44
52 0.46
53 0.42
54 0.46
55 0.51
56 0.57
57 0.61
58 0.63
59 0.67
60 0.74
61 0.78
62 0.77
63 0.7
64 0.61
65 0.58
66 0.55
67 0.52
68 0.53
69 0.46
70 0.45
71 0.47
72 0.48
73 0.47
74 0.44
75 0.42
76 0.36
77 0.39
78 0.42
79 0.46
80 0.48
81 0.5
82 0.53
83 0.58
84 0.59
85 0.63
86 0.6
87 0.58
88 0.62
89 0.63
90 0.61
91 0.54
92 0.52
93 0.43
94 0.4
95 0.36
96 0.34
97 0.32
98 0.32
99 0.31
100 0.29
101 0.3
102 0.28
103 0.27
104 0.23
105 0.21
106 0.2
107 0.23
108 0.23
109 0.22
110 0.24
111 0.23
112 0.24
113 0.23
114 0.21
115 0.16
116 0.15
117 0.14
118 0.12
119 0.14
120 0.16
121 0.19
122 0.21
123 0.22
124 0.27
125 0.34
126 0.35
127 0.35
128 0.33
129 0.32
130 0.32
131 0.35
132 0.36
133 0.31
134 0.31
135 0.32
136 0.31
137 0.31
138 0.31
139 0.35
140 0.36
141 0.44
142 0.44
143 0.43
144 0.43
145 0.41
146 0.37
147 0.31
148 0.26
149 0.2
150 0.17
151 0.15
152 0.12
153 0.12
154 0.11
155 0.09
156 0.07
157 0.04
158 0.03
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.03
171 0.04
172 0.08
173 0.12
174 0.14
175 0.15
176 0.18
177 0.22
178 0.28
179 0.34
180 0.38
181 0.46
182 0.45
183 0.5
184 0.57
185 0.55
186 0.49
187 0.47
188 0.4
189 0.36
190 0.39
191 0.34
192 0.26
193 0.25
194 0.23
195 0.21
196 0.2
197 0.12
198 0.1
199 0.08
200 0.07
201 0.07
202 0.07
203 0.06
204 0.06
205 0.06
206 0.07
207 0.08
208 0.08
209 0.08
210 0.08
211 0.09
212 0.08
213 0.09
214 0.09
215 0.08
216 0.08
217 0.08
218 0.07
219 0.07
220 0.06
221 0.07
222 0.09
223 0.16
224 0.24
225 0.29
226 0.33
227 0.34
228 0.42
229 0.51
230 0.59
231 0.63
232 0.65
233 0.7
234 0.77
235 0.87
236 0.84
237 0.78
238 0.74
239 0.69
240 0.68
241 0.67
242 0.6
243 0.56
244 0.58
245 0.58
246 0.6
247 0.6
248 0.52
249 0.43
250 0.4
251 0.38
252 0.35
253 0.34
254 0.28
255 0.23
256 0.22
257 0.22
258 0.23
259 0.18
260 0.14
261 0.12
262 0.13
263 0.12
264 0.15
265 0.18
266 0.18
267 0.19
268 0.18
269 0.21
270 0.22
271 0.27
272 0.33
273 0.32
274 0.36
275 0.36
276 0.36
277 0.32
278 0.28
279 0.23
280 0.15
281 0.12
282 0.06
283 0.06
284 0.06
285 0.06
286 0.06
287 0.06
288 0.05
289 0.05
290 0.05
291 0.05
292 0.06
293 0.07
294 0.07
295 0.08
296 0.08
297 0.08
298 0.08
299 0.08
300 0.07
301 0.06
302 0.08
303 0.08
304 0.08
305 0.11
306 0.14
307 0.14
308 0.15
309 0.17
310 0.15
311 0.18
312 0.21
313 0.18
314 0.19
315 0.23
316 0.28
317 0.31
318 0.31
319 0.28
320 0.31
321 0.32
322 0.35
323 0.34
324 0.33
325 0.31
326 0.33
327 0.36
328 0.31
329 0.35
330 0.31
331 0.29
332 0.28
333 0.28
334 0.27
335 0.24
336 0.22
337 0.18
338 0.16
339 0.13
340 0.1
341 0.08
342 0.07
343 0.09
344 0.09
345 0.09
346 0.1
347 0.1
348 0.11
349 0.1
350 0.09
351 0.08
352 0.1
353 0.11
354 0.11
355 0.11
356 0.11
357 0.13
358 0.14
359 0.13
360 0.12
361 0.12
362 0.12
363 0.13
364 0.13
365 0.14
366 0.15
367 0.15
368 0.17
369 0.19
370 0.24
371 0.33
372 0.4
373 0.45
374 0.54
375 0.64
376 0.71
377 0.79